Necdin Antibody (1B3) [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Necdin Primary Antibodies

Order Details


    • Catalog Number
      H00004692-M02AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Necdin Antibody (1B3) [Alexa Fluor® 405] Summary

Immunogen
NDN (NP_002478 222 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Specificity
NDN - necdin homolog (mouse)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 405
Format
Alexa Fluor 405 (A=405, E=421)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation and ELISA.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for Necdin Antibody (1B3) [Alexa Fluor® 405]

  • HsT16328
  • necdin (mouse) homolog
  • necdin homolog (mouse)
  • necdin
  • PWCR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83280
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
NB500-240
Species: Hu, Mu
Applications: WB, IP
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-13243
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for Necdin Antibody (H00004692-M02AF405) (0)

There are no publications for Necdin Antibody (H00004692-M02AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Necdin Antibody (H00004692-M02AF405) (0)

There are no reviews for Necdin Antibody (H00004692-M02AF405). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Necdin Antibody (H00004692-M02AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Necdin Products

Related Products by Gene

Bioinformatics Tool for Necdin Antibody (H00004692-M02AF405)

Discover related pathways, diseases and genes to Necdin Antibody (H00004692-M02AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Necdin Antibody (H00004692-M02AF405)

Discover more about diseases related to Necdin Antibody (H00004692-M02AF405).
 

Pathways for Necdin Antibody (H00004692-M02AF405)

View related products by pathway.

PTMs for Necdin Antibody (H00004692-M02AF405)

Learn more about PTMs related to Necdin Antibody (H00004692-M02AF405).
 

Research Areas for Necdin Antibody (H00004692-M02AF405)

Find related products by research area.

Blogs on Necdin

There are no specific blogs for Necdin, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Necdin Antibody (1B3) [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol NDN