NECAB1 Antibody

Images

 
Western Blot: NECAB1 Antibody [NBP1-98568] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Product Discontinued
View other related NECAB1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-98568
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NECAB1 Antibody Summary

Immunogen
The immunogen for this antibody is Necab1 - C-terminal region. Peptide sequence HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY.
Clonality
Polyclonal
Host
Rabbit
Gene
NECAB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NECAB1 Antibody

  • EF hand calcium binding protein 1
  • EFCBP1
  • EF-hand calcium binding protein 1
  • EF-hand calcium-binding protein 1
  • neuronal calcium binding protein
  • Neuronal calcium-binding protein 1
  • N-terminal EF-hand calcium binding protein 1
  • N-terminal EF-hand calcium-binding protein 1
  • STIP-1
  • synaptotagmin interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-84002
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56552
Species: Hu
Applications: WB
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003208-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NLS415
Species: Hu, Mk
Applications: IHC-P
NBP1-00958
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88219
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-98568
Species: Mu
Applications: WB

Publications for NECAB1 Antibody (NBP1-98568) (0)

There are no publications for NECAB1 Antibody (NBP1-98568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAB1 Antibody (NBP1-98568) (0)

There are no reviews for NECAB1 Antibody (NBP1-98568). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NECAB1 Antibody (NBP1-98568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NECAB1 Antibody Products

Related Products by Gene

Bioinformatics Tool for NECAB1 Antibody (NBP1-98568)

Discover related pathways, diseases and genes to NECAB1 Antibody (NBP1-98568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NECAB1 Antibody (NBP1-98568)

Discover more about diseases related to NECAB1 Antibody (NBP1-98568).
 

Pathways for NECAB1 Antibody (NBP1-98568)

View related products by pathway.

Blogs on NECAB1

There are no specific blogs for NECAB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NECAB1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98568 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.