NECAB1 Antibody


Western Blot: NECAB1 Antibody [NBP1-98568] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Product Discontinued
View other related NECAB1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NECAB1 Antibody Summary

The immunogen for this antibody is Necab1 - C-terminal region. Peptide sequence HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NECAB1 Antibody

  • EF hand calcium binding protein 1
  • EFCBP1
  • EF-hand calcium binding protein 1
  • EF-hand calcium-binding protein 1
  • neuronal calcium binding protein
  • Neuronal calcium-binding protein 1
  • N-terminal EF-hand calcium binding protein 1
  • N-terminal EF-hand calcium-binding protein 1
  • STIP-1
  • synaptotagmin interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for NECAB1 Antibody (NBP1-98568) (0)

There are no publications for NECAB1 Antibody (NBP1-98568).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAB1 Antibody (NBP1-98568) (0)

There are no reviews for NECAB1 Antibody (NBP1-98568). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NECAB1 Antibody (NBP1-98568) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NECAB1 Products

Bioinformatics Tool for NECAB1 Antibody (NBP1-98568)

Discover related pathways, diseases and genes to NECAB1 Antibody (NBP1-98568). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NECAB1 Antibody (NBP1-98568)

Discover more about diseases related to NECAB1 Antibody (NBP1-98568).

Pathways for NECAB1 Antibody (NBP1-98568)

View related products by pathway.

Blogs on NECAB1

There are no specific blogs for NECAB1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NECAB1 Antibody and receive a gift card or discount.


Gene Symbol NECAB1