NDUFB1 Antibody


Western Blot: NDUFB1 Antibody [NBP2-57170] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NDUFB1 Antibody [NBP2-57170] - Staining of human cell line MCF7 shows localization to mitochondria.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

NDUFB1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFB1 Recombinant Protein Antigen (NBP2-57170PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NDUFB1 Antibody

  • complex I MNLL subunit
  • Complex I-MNLL
  • MNLL
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (7kD, MNLL)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
  • NADH-ubiquinone oxidoreductase MNLL subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for NDUFB1 Antibody (NBP2-57170) (0)

There are no publications for NDUFB1 Antibody (NBP2-57170).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB1 Antibody (NBP2-57170) (0)

There are no reviews for NDUFB1 Antibody (NBP2-57170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB1 Antibody (NBP2-57170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NDUFB1 Products

Bioinformatics Tool for NDUFB1 Antibody (NBP2-57170)

Discover related pathways, diseases and genes to NDUFB1 Antibody (NBP2-57170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NDUFB1

There are no specific blogs for NDUFB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFB1 Antibody and receive a gift card or discount.


Gene Symbol NDUFB1