NDUFA9 Antibody (3D7) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related NDUFA9 Primary Antibodies

Order Details


    • Catalog Number
      H00004704-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NDUFA9 Antibody (3D7) [DyLight 488] Summary

Immunogen
NDUFA9 (NP_004993 303 a.a. - 377 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Specificity
NDUFA9 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFA9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA9 Antibody (3D7) [DyLight 488]

  • CC6
  • CI39k
  • CI-39k
  • CI-39kD
  • complex I 39kDa subunit
  • Complex I-39kD
  • MGC111043
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  • NADH-ubiquinone oxidoreductase 39 kDa subunit
  • NDUFS2L
  • SDR22E1
  • short chain dehydrogenase/reductase family 22E, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-46127
Species: Hu
Applications: WB, IHC
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFA9 Antibody (H00004704-M01G) (0)

There are no publications for NDUFA9 Antibody (H00004704-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA9 Antibody (H00004704-M01G) (0)

There are no reviews for NDUFA9 Antibody (H00004704-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA9 Antibody (H00004704-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA9 Products

Bioinformatics Tool for NDUFA9 Antibody (H00004704-M01G)

Discover related pathways, diseases and genes to NDUFA9 Antibody (H00004704-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA9 Antibody (H00004704-M01G)

Discover more about diseases related to NDUFA9 Antibody (H00004704-M01G).
 

Pathways for NDUFA9 Antibody (H00004704-M01G)

View related products by pathway.

PTMs for NDUFA9 Antibody (H00004704-M01G)

Learn more about PTMs related to NDUFA9 Antibody (H00004704-M01G).
 

Research Areas for NDUFA9 Antibody (H00004704-M01G)

Find related products by research area.

Blogs on NDUFA9

There are no specific blogs for NDUFA9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA9 Antibody (3D7) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA9