NDRG2 Antibody

Images

 
Western Blot: NDRG2 Antibody [NBP1-74147] - Mouse Kidney Lysate 1.0 ug/ml gel concentration 12%

Product Details

Summary
Product Discontinued
View other related NDRG2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74147
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NDRG2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Ndrg2. Immunizing peptide sequence TEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPK.
Clonality
Polyclonal
Host
Rabbit
Gene
NDRG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ndrg2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NDRG2 Antibody

  • DKFZp781G1938
  • FLJ25522
  • KIAA1248cytoplasmic protein Ndr1
  • NDR1-related protein NDR2
  • NDRG family member 2
  • protein NDRG2
  • Protein Syld709613
  • syld709613 protein
  • SYLDN-myc downstream regulator 2

Background

Ndrg2 may be involved in dendritic cell and neuron differentiation By similarity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-45983
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00065009-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86046
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
MAB5248
Species: Hu
Applications: IHC
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P

Publications for NDRG2 Antibody (NBP1-74147) (0)

There are no publications for NDRG2 Antibody (NBP1-74147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDRG2 Antibody (NBP1-74147) (0)

There are no reviews for NDRG2 Antibody (NBP1-74147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDRG2 Antibody (NBP1-74147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG2 Products

Bioinformatics Tool for NDRG2 Antibody (NBP1-74147)

Discover related pathways, diseases and genes to NDRG2 Antibody (NBP1-74147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG2 Antibody (NBP1-74147)

Discover more about diseases related to NDRG2 Antibody (NBP1-74147).
 

Pathways for NDRG2 Antibody (NBP1-74147)

View related products by pathway.

PTMs for NDRG2 Antibody (NBP1-74147)

Learn more about PTMs related to NDRG2 Antibody (NBP1-74147).

Blogs on NDRG2

There are no specific blogs for NDRG2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG2
Uniprot