NCOA4 Antibody


Western Blot: NCOA4 Antibody [NBP1-69121] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Product Discontinued
View other related NCOA4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NCOA4 Antibody Summary

Synthetic peptides corresponding to Ncoa4 (nuclear receptor coactivator 4) The peptide sequence was selected from the N terminal of Ncoa4. Peptide sequence CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ncoa4 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
NCOA4 Lysate (NBP2-64955)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NCOA4 Antibody

  • Androgen receptor coactivator 70 kDa protein
  • Androgen receptor-associated protein of 70 kDa
  • ARA70RFGret fused
  • DKFZp762E1112
  • ELE1NCoA-4
  • nuclear receptor coactivator 4,70 kDa AR-activator
  • PTC3RET-activating gene ELE1
  • Ret-activating protein ELE1,70 kDa androgen receptor coactivator


The function of Ncoa4 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF

Publications for NCOA4 Antibody (NBP1-69121) (0)

There are no publications for NCOA4 Antibody (NBP1-69121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA4 Antibody (NBP1-69121) (0)

There are no reviews for NCOA4 Antibody (NBP1-69121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCOA4 Antibody (NBP1-69121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional NCOA4 Products

Bioinformatics Tool for NCOA4 Antibody (NBP1-69121)

Discover related pathways, diseases and genes to NCOA4 Antibody (NBP1-69121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA4 Antibody (NBP1-69121)

Discover more about diseases related to NCOA4 Antibody (NBP1-69121).

Pathways for NCOA4 Antibody (NBP1-69121)

View related products by pathway.

PTMs for NCOA4 Antibody (NBP1-69121)

Learn more about PTMs related to NCOA4 Antibody (NBP1-69121).

Blogs on NCOA4

There are no specific blogs for NCOA4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCOA4 Antibody and receive a gift card or discount.


Gene Symbol NCOA4