NCKIPSD Antibody

Images

 
Western Blot: NCKIPSD Antibody [NBP1-69102] - Human Fetal liver Cell Lysate, concentration 1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NCKIPSD Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69102
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NCKIPSD Antibody Summary

Immunogen
Synthetic peptides corresponding to NCKIPSD (NCK interacting protein with SH3 domain) The peptide sequence was selected from the middle region of NCKIPSD. Peptide sequence LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG.
Clonality
Polyclonal
Host
Rabbit
Gene
NCKIPSD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NCKIPSD and was validated on Western blot.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NCKIPSD Antibody

  • 54 kDa vimentin-interacting protein
  • 90 kDa SH3 protein interacting with Nck
  • AF3p21
  • AF3P21DIP-1
  • dia interacting protein
  • Dia-interacting protein 1
  • diaphanous protein interacting protein
  • Diaphanous protein-interacting protein
  • DIP
  • DIP1
  • MGC23891
  • NCK interacting protein with SH3 domain
  • ORF1
  • SPIN90VIP54
  • WASLBP
  • WASP-interacting SH3-domain protein
  • WISHSH3 adapter protein SPIN90
  • Wisk90 kDa

Background

The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-63066
Species: Vi
Applications: ELISA, IP
AF7177
Species: Hu
Applications: WB, ICC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-89130
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69102
Species: Hu
Applications: WB

Publications for NCKIPSD Antibody (NBP1-69102) (0)

There are no publications for NCKIPSD Antibody (NBP1-69102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKIPSD Antibody (NBP1-69102) (0)

There are no reviews for NCKIPSD Antibody (NBP1-69102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCKIPSD Antibody (NBP1-69102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCKIPSD Products

Bioinformatics Tool for NCKIPSD Antibody (NBP1-69102)

Discover related pathways, diseases and genes to NCKIPSD Antibody (NBP1-69102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKIPSD Antibody (NBP1-69102)

Discover more about diseases related to NCKIPSD Antibody (NBP1-69102).
 

Pathways for NCKIPSD Antibody (NBP1-69102)

View related products by pathway.

PTMs for NCKIPSD Antibody (NBP1-69102)

Learn more about PTMs related to NCKIPSD Antibody (NBP1-69102).

Blogs on NCKIPSD

There are no specific blogs for NCKIPSD, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCKIPSD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCKIPSD