NCKIPSD Antibody



Product Details

Product Discontinued
View other related NCKIPSD Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NCKIPSD Antibody Summary

Synthetic peptides corresponding to NCKIPSD (NCK interacting protein with SH3 domain) The peptide sequence was selected from the middle region of NCKIPSD. Peptide sequence LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against NCKIPSD and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
79 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Vi
Applications: ELISA, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
Species: Mu
Applications: B/N, ELISA, Func, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NCKIPSD Antibody (NBP1-69102) (0)

There are no publications for NCKIPSD Antibody (NBP1-69102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKIPSD Antibody (NBP1-69102) (0)

There are no reviews for NCKIPSD Antibody (NBP1-69102). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for NCKIPSD Antibody (NBP1-69102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCKIPSD Antibody Products

Related Products by Gene

Bioinformatics Tool for NCKIPSD Antibody (NBP1-69102)

Discover related pathways, diseases and genes to NCKIPSD Antibody (NBP1-69102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKIPSD Antibody (NBP1-69102)

Discover more about diseases related to NCKIPSD Antibody (NBP1-69102).

Pathways for NCKIPSD Antibody (NBP1-69102)

View related products by pathway.

PTMs for NCKIPSD Antibody (NBP1-69102)

Learn more about PTMs related to NCKIPSD Antibody (NBP1-69102).

Blogs on NCKIPSD

There are no specific blogs for NCKIPSD, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol NCKIPSD

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69102 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.