NCAM-1/CD56 Antibody (3G12)

Images

 
Western Blot: NCAM-1/CD56 Antibody (3G12) [H00004684-M01] - Analysis of NCAM1 expression in transfected 293T cell line by NCAM1 monoclonal antibody (M01), clone 3G12.Lane 1: NCAM1 transfected lysate(94.6 KDa).Lane 2: ...read more
Sandwich ELISA: NCAM-1/CD56 Antibody (3G12) [H00004684-M01] - Detection limit for recombinant GST tagged NCAM1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NCAM-1/CD56 Antibody (3G12) Summary

Immunogen
NCAM1 (AAH47244, 611 a.a. - 710 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Specificity
NCAM1 - neural cell adhesion molecule 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NCAM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004684-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NCAM-1/CD56 Antibody (3G12)

  • CD56 / NCAM-1
  • CD56 antigen
  • CD56
  • MSK39
  • NCAM1
  • N-CAM-1
  • NCAM-1
  • NCAMantigen recognized by monoclonal 5.1H11
  • neural cell adhesion molecule 1
  • neural cell adhesion molecule, NCAM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro

Publications for NCAM-1/CD56 Antibody (H00004684-M01)(1)

Reviews for NCAM-1/CD56 Antibody (H00004684-M01) (0)

There are no reviews for NCAM-1/CD56 Antibody (H00004684-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCAM-1/CD56 Antibody (H00004684-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCAM-1/CD56 Products

Bioinformatics Tool for NCAM-1/CD56 Antibody (H00004684-M01)

Discover related pathways, diseases and genes to NCAM-1/CD56 Antibody (H00004684-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAM-1/CD56 Antibody (H00004684-M01)

Discover more about diseases related to NCAM-1/CD56 Antibody (H00004684-M01).
 

Pathways for NCAM-1/CD56 Antibody (H00004684-M01)

View related products by pathway.

PTMs for NCAM-1/CD56 Antibody (H00004684-M01)

Learn more about PTMs related to NCAM-1/CD56 Antibody (H00004684-M01).
 

Research Areas for NCAM-1/CD56 Antibody (H00004684-M01)

Find related products by research area.

Blogs on NCAM-1/CD56

There are no specific blogs for NCAM-1/CD56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCAM-1/CD56 Antibody (3G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAM1
Entrez
OMIM
Uniprot