Nbs1 Antibody (3E4.)

Images

 
Western Blot: Nbs1 Antibody (3E4) [H00004683-M01] - NBN monoclonal antibody (M01), clone 3E4 Analysis of NBN expression in HL-60.
Western Blot: Nbs1 Antibody (3E4) [H00004683-M01] - Analysis of NBN expression in COLO 320 HSR ( Cat # L014V1 ).
Sandwich ELISA: Nbs1 Antibody (3E4) [H00004683-M01] - Detection limit for recombinant GST tagged NBN is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nbs1 Antibody (3E4.) Summary

Immunogen
NBN (NP_002476 645 a.a. - 754 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Specificity
NBN (3E4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NBN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nbs1 Antibody (3E4.)

  • ATV
  • AT-V1
  • AT-V2
  • Cell cycle regulatory protein p95
  • FLJ10155
  • MGC87362
  • NBN
  • Nbs1
  • NBS1P95
  • NBSNijmegen breakage syndrome protein 1
  • Nibrin
  • Nijmegen breakage syndrome 1 (nibrin)
  • p95 protein of the MRE11/RAD50 complex
  • p95

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004683-M01
Species: Hu
Applications: WB, ELISA

Publications for Nbs1 Antibody (H00004683-M01) (0)

There are no publications for Nbs1 Antibody (H00004683-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nbs1 Antibody (H00004683-M01) (0)

There are no reviews for Nbs1 Antibody (H00004683-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nbs1 Antibody (H00004683-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nbs1 Products

Bioinformatics Tool for Nbs1 Antibody (H00004683-M01)

Discover related pathways, diseases and genes to Nbs1 Antibody (H00004683-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nbs1 Antibody (H00004683-M01)

Discover more about diseases related to Nbs1 Antibody (H00004683-M01).
 

Pathways for Nbs1 Antibody (H00004683-M01)

View related products by pathway.

PTMs for Nbs1 Antibody (H00004683-M01)

Learn more about PTMs related to Nbs1 Antibody (H00004683-M01).
 

Research Areas for Nbs1 Antibody (H00004683-M01)

Find related products by research area.

Blogs on Nbs1.

The MRE11 Complex and DNA Damage Response
The maintenance of genome stability depends on the DNA damage response (DDR) which is a complex signaling network including cell cycle checkpoints, DNA repair and damage tolerance pathways. The DDR complex has the ability to sense DNA damage and tra...  Read full blog post.

NBS1: The DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

NBS1: DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nbs1 Antibody (3E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol NBN
Entrez
OMIM
Uniprot