Nbs1 Antibody (2C7)

Images

 
Sandwich ELISA: Nbs1 Antibody (2C7) [H00004683-M02] - Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Nbs1 Primary Antibodies

Order Details


    • Catalog Number
      H00004683-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nbs1 Antibody (2C7) Summary

Immunogen
NBN (NP_002476 645 a.a. - 754 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NBN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nbs1 Antibody (2C7)

  • ATV
  • AT-V1
  • AT-V2
  • Cell cycle regulatory protein p95
  • FLJ10155
  • MGC87362
  • NBN
  • Nbs1
  • NBS1P95
  • NBSNijmegen breakage syndrome protein 1
  • Nibrin
  • Nijmegen breakage syndrome 1 (nibrin)
  • p95 protein of the MRE11/RAD50 complex
  • p95

Background

The p95 gene (identical to NBS1 and nibrin) is a member of the hMre11/hRad50 double-strand break complex (MRN complex). This protein complex has been implicated in Nijmegen breakage syndrome, an autosomal recessive disorder marked by increased cancer incidence, cell cycle checkpoint deficits, and ionizing radiation sensitivity, thus revealing a direct molecular link between double-strand break repair and cell cycle checkpoint functions. In case of infection by adenovirus E4, the MRN complex is inactivated and degraded by viral oncoproteins, thereby preventing concatenation of viral genomes in infected cells. NBS1 is expressed ubiquitously and presents high levels in testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004683-M02
Species: Hu
Applications: WB, ELISA

Publications for Nbs1 Antibody (H00004683-M02) (0)

There are no publications for Nbs1 Antibody (H00004683-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nbs1 Antibody (H00004683-M02) (0)

There are no reviews for Nbs1 Antibody (H00004683-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nbs1 Antibody (H00004683-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nbs1 Products

Bioinformatics Tool for Nbs1 Antibody (H00004683-M02)

Discover related pathways, diseases and genes to Nbs1 Antibody (H00004683-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nbs1 Antibody (H00004683-M02)

Discover more about diseases related to Nbs1 Antibody (H00004683-M02).
 

Pathways for Nbs1 Antibody (H00004683-M02)

View related products by pathway.

PTMs for Nbs1 Antibody (H00004683-M02)

Learn more about PTMs related to Nbs1 Antibody (H00004683-M02).
 

Research Areas for Nbs1 Antibody (H00004683-M02)

Find related products by research area.

Blogs on Nbs1.

The MRE11 Complex and DNA Damage Response
The maintenance of genome stability depends on the DNA damage response (DDR) which is a complex signaling network including cell cycle checkpoints, DNA repair and damage tolerance pathways. The DDR complex has the ability to sense DNA damage and tra...  Read full blog post.

NBS1: The DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

NBS1: DNA Repair Trigger
NBS1 (Nijmegen breakage syndrome protein 1) is a component of the MRN complex (Mre11-Rad50-Nbs1) that plays important role in detecting DNA double strand breaks (DSBs) and triggering the downstream cascade. DSBs can be caused by ionizing radiation, ch...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nbs1 Antibody (2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NBN
Entrez
Uniprot