NBR1 Antibody (5C3)

Images

 
Western Blot: NBR1 Antibody (5C3) [H00004077-M05A] - Analysis of NBR1 expression in transfected 293T cell line by NBR1 monoclonal antibody (M05A), clone 5C3. Lane 1: NBR1 transfected lysatE (107.4 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NBR1 Antibody (5C3) Summary

Immunogen
NBR1 (NP_005890, 2 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Specificity
NBR1 - neighbor of BRCA1 gene 1 (5C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NBR1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NBR1 Antibody (5C3)

  • Cell migration-inducing gene 19 protein
  • FLJ98272
  • KIAA0049CA125
  • M17S2FLJ55359,1A1-3B
  • Membrane component chromosome 17 surface marker 2,1A13B
  • membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125)
  • migration-inducing protein 19
  • Neighbor of BRCA1 gene 1 protein
  • neighbor of BRCA1 gene 1
  • next to BRCA1 gene 1 protein
  • Protein 1A1-3B

Background

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00010230-P01
Species: Hu
NBP1-84432
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46224
Species: Hu
Applications: WB, IHC
H00004077-M05A
Species: Hu
Applications: WB, ELISA

Publications for NBR1 Antibody (H00004077-M05A) (0)

There are no publications for NBR1 Antibody (H00004077-M05A).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NBR1 Antibody (H00004077-M05A) (0)

There are no reviews for NBR1 Antibody (H00004077-M05A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NBR1 Antibody (H00004077-M05A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NBR1 Products

Bioinformatics Tool for NBR1 Antibody (H00004077-M05A)

Discover related pathways, diseases and genes to NBR1 Antibody (H00004077-M05A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NBR1 Antibody (H00004077-M05A)

Discover more about diseases related to NBR1 Antibody (H00004077-M05A).
 

Pathways for NBR1 Antibody (H00004077-M05A)

View related products by pathway.

PTMs for NBR1 Antibody (H00004077-M05A)

Learn more about PTMs related to NBR1 Antibody (H00004077-M05A).

Blogs on NBR1.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NBR1 Antibody (5C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NBR1
Entrez
Uniprot