Nav1.7 Antibody

Immunocytochemistry/Immunofluorescence: Nav1.7 Antibody [NBP2-57651] - Staining of human cell line BJ shows localization to plasma membrane, actin filaments & focal adhesion sites. Antibody staining is shown in green.

Product Discontinued

Nav1.7 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSP
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCN9A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nav1.7 Antibody

• ETHA
• FEB3B
• hNE-Na
• Nav1.7
• NENA
• NE-NA
• NENAVoltage-gated sodium channel subunit alpha Nav1.7
• Neuroendocrine sodium channel
• Peripheral sodium channel 1
• PN1
• PN1hNE-Na
• SCN9A
• sodium channel protein type 9 subunit alpha
• Sodium channel protein type IX subunit alpha
• sodium channel, voltage-gated, type IX, alpha subunit
• voltage-gated sodium channel alpha subunit Nav1.7
• voltage-gated, type IX, alpha polypeptide

Background

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain (from SwissProt).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN9A