Natriuretic Peptide Receptor B Antibody


Western Blot: Natriuretic Peptide Receptor B Antibody [NBP1-82538] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression more
Immunocytochemistry/ Immunofluorescence: Natriuretic Peptide Receptor B Antibody [NBP1-82538] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor B Antibody [NBP1-82538] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Natriuretic Peptide Receptor B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Natriuretic Peptide Receptor B Recombinant Protein Antigen (NBP1-82538PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Natriuretic Peptide Receptor B Antibody

  • AMDM
  • atrial natriuretic peptide receptor type B
  • ECDM
  • GUC2B
  • GUCY2B
  • natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B)
  • NPRB
  • NPRBi


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Natriuretic Peptide Receptor B Antibody (NBP1-82538) (0)

There are no publications for Natriuretic Peptide Receptor B Antibody (NBP1-82538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Natriuretic Peptide Receptor B Antibody (NBP1-82538) (0)

There are no reviews for Natriuretic Peptide Receptor B Antibody (NBP1-82538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Natriuretic Peptide Receptor B Antibody (NBP1-82538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Natriuretic Peptide Receptor B Products

Bioinformatics Tool for Natriuretic Peptide Receptor B Antibody (NBP1-82538)

Discover related pathways, diseases and genes to Natriuretic Peptide Receptor B Antibody (NBP1-82538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Natriuretic Peptide Receptor B Antibody (NBP1-82538)

Discover more about diseases related to Natriuretic Peptide Receptor B Antibody (NBP1-82538).

Pathways for Natriuretic Peptide Receptor B Antibody (NBP1-82538)

View related products by pathway.

PTMs for Natriuretic Peptide Receptor B Antibody (NBP1-82538)

Learn more about PTMs related to Natriuretic Peptide Receptor B Antibody (NBP1-82538).

Research Areas for Natriuretic Peptide Receptor B Antibody (NBP1-82538)

Find related products by research area.

Blogs on Natriuretic Peptide Receptor B

There are no specific blogs for Natriuretic Peptide Receptor B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Natriuretic Peptide Receptor B Antibody and receive a gift card or discount.


Gene Symbol NPR2