NARG1 Antibody


Western Blot: NARG1 Antibody [NBP1-57091] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: NARG1 Antibody [NBP1-57091] - Human kidney lysate, concentration 0.2-1 ug/ml.
Western Blot: NARG1 Antibody [NBP1-57091] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: NARG1 Antibody [NBP1-57091] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related NARG1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NARG1 Antibody Summary

Synthetic peptides corresponding to NARG1(NMDA receptor regulated 1) The peptide sequence was selected from the N terminal of NARG1. Peptide sequence LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NARG1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NARG1 Antibody

  • FLJ13340
  • GA19
  • Gastric cancer antigen Ga19
  • N(alpha)-acetyltransferase 15, NatA auxiliary subunit
  • NARG1
  • NATHGa19
  • NMDA receptor-regulated protein 1
  • N-terminal acetyltransferase
  • Protein tubedown-1
  • Tbdn100
  • TBDN100NatA auxiliary subunit
  • transcriptional coactivator tubedown-100
  • tubedown-1


The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, TCS
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for NARG1 Antibody (NBP1-57091) (0)

There are no publications for NARG1 Antibody (NBP1-57091).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARG1 Antibody (NBP1-57091) (0)

There are no reviews for NARG1 Antibody (NBP1-57091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NARG1 Antibody (NBP1-57091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-57091

Bioinformatics Tool for NARG1 Antibody (NBP1-57091)

Discover related pathways, diseases and genes to NARG1 Antibody (NBP1-57091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NARG1 Antibody (NBP1-57091)

Discover more about diseases related to NARG1 Antibody (NBP1-57091).

Pathways for NARG1 Antibody (NBP1-57091)

View related products by pathway.

PTMs for NARG1 Antibody (NBP1-57091)

Learn more about PTMs related to NARG1 Antibody (NBP1-57091).

Research Areas for NARG1 Antibody (NBP1-57091)

Find related products by research area.

Blogs on NARG1

There are no specific blogs for NARG1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NARG1 Antibody and receive a gift card or discount.


Gene Symbol NAA15