NARG1 Antibody (4A11) - Azide and BSA Free Summary
| Immunogen |
NARG1 (NP_476516.1, 764 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEEL |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NAA15 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NARG1 Antibody (4A11) - Azide and BSA Free
Background
NARG1 (NMDA receptor-regulated 1) is also known as NATH (N-acetyltransferase). The NARG1 gene, along with NARG2 and NARG3, was originally identified as a gene regulated by NMDA receptors in developing neurons. The NARG1 gene was found to be a homolog of a yeast N-terminal acetyltransferase that functions in control of the G(0) phase of the cell cycle. NARG1 was also identified as NATH in experiments set out to identify genes differentially expressed in papillary thyroid carcinoma (PTC). The NATH protein has been shown to form a complex with human ARD1 where they function as an acetyltransferase and interact with ribosomal subunits. The ARD1/NATH complex plays an important role in cell survival. Alternative names for NARG1 include protein tubedown-1, Tbdn100, gastric cancer antigen Ga19, and GA19.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Publications for NARG1 Antibody (H00080155-M01-100ug) (0)
There are no publications for NARG1 Antibody (H00080155-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NARG1 Antibody (H00080155-M01-100ug) (0)
There are no reviews for NARG1 Antibody (H00080155-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NARG1 Antibody (H00080155-M01-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NARG1 Products
Array H00080155-M01-100ug
Research Areas for NARG1 Antibody (H00080155-M01-100ug)
Find related products by research area.
|
Blogs on NARG1