NALP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NALP4 Antibody [NBP1-85554] - Staining of human cell line U-2 OS shows positivity in centrosome.
Immunohistochemistry-Paraffin: NALP4 Antibody [NBP1-85554] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NALP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LMVSAYCLKYCSSLRKLCFSVQNVFKKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCNQLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NALP4 Protein (NBP1-85554PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NALP4 Antibody

  • Cancer/testis antigen 58
  • CLR19.5
  • CT58PYRIN and NACHT-containing protein 2
  • FLJ32126
  • NACHT, leucine rich repeat and PYD containing 4
  • NACHT, LRR and PYD domains-containing protein 4
  • NALP4NACHT, LRR and PYD containing protein 4
  • NLR family, pyrin domain containing 4
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 4
  • PAN2Ribonuclease inhibitor 2
  • PYPAF4PAAD and NACHT-containing protein 2
  • RNH2PYRIN-containing APAF1-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44286
Species: Hu
Applications: WB, IP
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
NBP1-85554
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NALP4 Antibody (NBP1-85554) (0)

There are no publications for NALP4 Antibody (NBP1-85554).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NALP4 Antibody (NBP1-85554) (0)

There are no reviews for NALP4 Antibody (NBP1-85554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NALP4 Antibody (NBP1-85554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NALP4 Products

Bioinformatics Tool for NALP4 Antibody (NBP1-85554)

Discover related pathways, diseases and genes to NALP4 Antibody (NBP1-85554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NALP4 Antibody (NBP1-85554)

Discover more about diseases related to NALP4 Antibody (NBP1-85554).
 

Pathways for NALP4 Antibody (NBP1-85554)

View related products by pathway.

PTMs for NALP4 Antibody (NBP1-85554)

Learn more about PTMs related to NALP4 Antibody (NBP1-85554).

Blogs on NALP4.

NALP4 - Mediator of Programmed Cell Death
The NALP family consists of cytoplasmic proteins within the larger CATERPILLER protein family. There exist in short forms (such as NALP4) and long forms (NALP1). NALP proteins include the apoptosis regulator apoptotic protease activating factor 1 (APA...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NALP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP4