NALP12 Antibody (3B5)

Images

 
Sandwich ELISA: NALP12 Antibody (3B5) [H00091662-M01] - Detection limit for recombinant GST tagged NALP12 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NALP12 Antibody (3B5) Summary

Immunogen
NALP12 (AAH28069, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGK IPWGSMEKAGPLEMAQLLITHFGPEEAWRLALSTFERINRKD LWERGQREDLVRDTPPGGPSSLGNQS
Localization
Cytoplasmic
Specificity
NALP12 - NACHT, leucine rich repeat and PYD containing 12
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NLRP12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NALP12 Antibody (3B5)

  • FCAS2
  • Monarch-1
  • NACHT, leucine rich repeat and PYD containing 12
  • NACHT, LRR and PYD domains-containing protein 12
  • NALP12LRR and PYD containing protein 12
  • NLR family, pyrin domain containing 12
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12
  • PYPAF7Monarch1
  • PYRIN-containing APAF1-like protein 7
  • Regulated by nitric oxide
  • RNO2

Background

This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Alternatively spliced transcript variants encoding distinct isoforms have been described but the full-length nature of some of these has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP

Publications for NALP12 Antibody (H00091662-M01) (0)

There are no publications for NALP12 Antibody (H00091662-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NALP12 Antibody (H00091662-M01) (0)

There are no reviews for NALP12 Antibody (H00091662-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NALP12 Antibody (H00091662-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NALP12 Products

Bioinformatics Tool for NALP12 Antibody (H00091662-M01)

Discover related pathways, diseases and genes to NALP12 Antibody (H00091662-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NALP12 Antibody (H00091662-M01)

Discover more about diseases related to NALP12 Antibody (H00091662-M01).
 

Pathways for NALP12 Antibody (H00091662-M01)

View related products by pathway.

PTMs for NALP12 Antibody (H00091662-M01)

Learn more about PTMs related to NALP12 Antibody (H00091662-M01).
 

Research Areas for NALP12 Antibody (H00091662-M01)

Find related products by research area.

Blogs on NALP12

There are no specific blogs for NALP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NALP12 Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP12
Entrez
Uniprot