N-WASP Antibody (5F4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related N-WASP Primary Antibodies

Order Details


    • Catalog Number
      H00008976-M04G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

N-WASP Antibody (5F4) [DyLight 488] Summary

Immunogen
WASL (NP_003932, 97 a.a. - 184 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH
Specificity
WASL - Wiskott-Aldrich syndrome-like
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WASL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-WASP Antibody (5F4) [DyLight 488]

  • NWASP
  • N-WASP
  • N-WASPneural WiskNWASP
  • TRS4
  • WASL
  • WiskDKFZp779G0847
  • WiskMGC48327

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7008
Species: Hu
Applications: WB, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for N-WASP Antibody (H00008976-M04G) (0)

There are no publications for N-WASP Antibody (H00008976-M04G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-WASP Antibody (H00008976-M04G) (0)

There are no reviews for N-WASP Antibody (H00008976-M04G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N-WASP Antibody (H00008976-M04G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-WASP Products

Bioinformatics Tool for N-WASP Antibody (H00008976-M04G)

Discover related pathways, diseases and genes to N-WASP Antibody (H00008976-M04G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-WASP Antibody (H00008976-M04G)

Discover more about diseases related to N-WASP Antibody (H00008976-M04G).
 

Pathways for N-WASP Antibody (H00008976-M04G)

View related products by pathway.

PTMs for N-WASP Antibody (H00008976-M04G)

Learn more about PTMs related to N-WASP Antibody (H00008976-M04G).
 

Research Areas for N-WASP Antibody (H00008976-M04G)

Find related products by research area.

Blogs on N-WASP

There are no specific blogs for N-WASP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-WASP Antibody (5F4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol WASL
Entrez