N-Cadherin Antibody (6G6)

Images

 
There are currently no images for N-Cadherin Antibody (H00001000-M08).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G6
Clonality
Monoclonal
Host
Mouse

Order Details

N-Cadherin Antibody (6G6) Summary

Immunogen
CDH2 (NP_001783 807 a.a. - 906 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Marker
Mesenchymal Cells Marker
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Cadherin Antibody (6G6)

  • cadherin 2, N-cadherin (neuronal)
  • cadherin 2, type 1, N-cadherin (neuronal)
  • Cadherin-2
  • CD325 antigen
  • CD325
  • CDH2
  • CDHNcalcium-dependent adhesion protein, neuronal
  • CDw325
  • NCadherin
  • N-Cadherin
  • NCADN-cadherin 1
  • Neural cadherin
  • neural-cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-91774
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-91717
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6677
Species: Mu
Applications: WB, IHC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
AF909
Species: Mu
Applications: WB, Simple Western, IHC, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for N-Cadherin Antibody (H00001000-M08) (0)

There are no publications for N-Cadherin Antibody (H00001000-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Cadherin Antibody (H00001000-M08) (0)

There are no reviews for N-Cadherin Antibody (H00001000-M08). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Cadherin Antibody (H00001000-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Cadherin Antibody (6G6) Products

Related Products by Gene

Bioinformatics Tool for N-Cadherin Antibody (H00001000-M08)

Discover related pathways, diseases and genes to N-Cadherin Antibody (H00001000-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Cadherin Antibody (H00001000-M08)

Discover more about diseases related to N-Cadherin Antibody (H00001000-M08).
 

Pathways for N-Cadherin Antibody (H00001000-M08)

View related products by pathway.

PTMs for N-Cadherin Antibody (H00001000-M08)

Learn more about PTMs related to N-Cadherin Antibody (H00001000-M08).
 

Research Areas for N-Cadherin Antibody (H00001000-M08)

Find related products by research area.

Blogs on N-Cadherin.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

MMP24 (Matrix metalloproteinase-24, matrix metalloproteinase-25, MT5-MMP)
MMP24 is an extracellular matrix (ECM) degradative peptidase enzyme that is a member of the large family of matrix metalloproteinases (MMP). Each MMP has a different substrate specificity, and the aberrant or derailed expression of these is strongly c...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our N-Cadherin Antibody (6G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH2
Entrez
Uniprot

Customers Who Bought This Also Bought