N-Cadherin Antibody (4D11)

Images

 

Product Details

Summary
Product Discontinued
View other related N-Cadherin Primary Antibodies

Order Details


    • Catalog Number
      H00001000-M07
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

N-Cadherin Antibody (4D11) Summary

Immunogen
CDH2 (NP_001783 807 a.a. - 906 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Marker
Mesenchymal Cells Marker
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Cadherin Antibody (4D11)

  • cadherin 2, N-cadherin (neuronal)
  • cadherin 2, type 1, N-cadherin (neuronal)
  • Cadherin-2
  • CD325 antigen
  • CD325
  • CDH2
  • CDHNcalcium-dependent adhesion protein, neuronal
  • CDw325
  • NCadherin
  • N-Cadherin
  • NCADN-cadherin 1
  • Neural cadherin
  • neural-cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for N-Cadherin Antibody (H00001000-M07) (0)

There are no publications for N-Cadherin Antibody (H00001000-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Cadherin Antibody (H00001000-M07) (0)

There are no reviews for N-Cadherin Antibody (H00001000-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Cadherin Antibody (H00001000-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Cadherin Products

Bioinformatics Tool for N-Cadherin Antibody (H00001000-M07)

Discover related pathways, diseases and genes to N-Cadherin Antibody (H00001000-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Cadherin Antibody (H00001000-M07)

Discover more about diseases related to N-Cadherin Antibody (H00001000-M07).
 

Pathways for N-Cadherin Antibody (H00001000-M07)

View related products by pathway.

PTMs for N-Cadherin Antibody (H00001000-M07)

Learn more about PTMs related to N-Cadherin Antibody (H00001000-M07).
 

Research Areas for N-Cadherin Antibody (H00001000-M07)

Find related products by research area.

Blogs on N-Cadherin.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

MMP24 (Matrix metalloproteinase-24, matrix metalloproteinase-25, MT5-MMP)
MMP24 is an extracellular matrix (ECM) degradative peptidase enzyme that is a member of the large family of matrix metalloproteinases (MMP). Each MMP has a different substrate specificity, and the aberrant or derailed expression of these is strongly c...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Cadherin Antibody (4D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH2
Entrez
Uniprot