MYT1L Antibody

Images

 
Immunohistochemistry: MYT1L Antibody [NBP2-31911] - Staining of liver.
Immunohistochemistry: MYT1L Antibody [NBP2-31911] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: MYT1L Antibody [NBP2-31911] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: MYT1L Antibody [NBP2-31911] - Staining of liver cancer.

Product Details

Summary
Product Discontinued
View other related MYT1L Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31911
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MYT1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYT1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYT1L Antibody

  • KIAA1106neural zinc finger transcription factor 1
  • myelin transcription factor 1-like protein
  • myelin transcription factor 1-like
  • MyT1L
  • MyT1-L
  • NZF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
AF3086
Species: Hu
Applications: WB, IHC
AF3444
Species: Hu
Applications: WB
NBP2-07463
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP1-92445
Species: Hu
Applications: IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
AF4377
Species: Hu, Mu
Applications: WB, ICC
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MYT1L Antibody (NBP2-31911) (0)

There are no publications for MYT1L Antibody (NBP2-31911).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYT1L Antibody (NBP2-31911) (0)

There are no reviews for MYT1L Antibody (NBP2-31911). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYT1L Antibody (NBP2-31911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYT1L Products

Bioinformatics Tool for MYT1L Antibody (NBP2-31911)

Discover related pathways, diseases and genes to MYT1L Antibody (NBP2-31911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYT1L Antibody (NBP2-31911)

Discover more about diseases related to MYT1L Antibody (NBP2-31911).
 

Pathways for MYT1L Antibody (NBP2-31911)

View related products by pathway.

Blogs on MYT1L

There are no specific blogs for MYT1L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYT1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYT1L
Uniprot