Myosin Phosphatase 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP1R12B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Myosin Phosphatase 2 Antibody - BSA Free
Background
PPP1R12B, also known as Protein phosphatase 1 regulatory subunit 12B, has 5 isoforms, a 982 amino acid isoform that is 110 kDa, a 386 amino acid isoform that is 43 kDa, a 224 amino acid isoform that is 26 kDa, a 208 amino acid isoform that is 24 kDa, and a 515 amino acid isoform that is 58 kDa; detected in skeletal muscle, fetal and adult heart, brain, placenta, kidney, spleen, thymus, pancreas and lung; with cytoplasmatic subcellular location; regulates myosin phosphatase activity and augments Ca(2+) sensitivity of the contractile apparatus. This protein is being studied for its involvement in breast cancer. The PPP1R12B protein has been shown to involve IL16, PPP1CB, PRKG1, HSPA8, MYL6, and MYL6B in RhoA pathway, PKA signaling, actin-based motility by Rho family GTPases, eIF2 pathway, CDK5 pathway, insulin pathway, G2/M transition, cell cycle, mitotic G2-G2/M phases, regulation of PLK1 activity at G2/M transition, cell cycle, mitotic, and vascular smooth muscle contraction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Myosin Phosphatase 2 Antibody (NBP1-87750) (0)
There are no publications for Myosin Phosphatase 2 Antibody (NBP1-87750).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin Phosphatase 2 Antibody (NBP1-87750) (0)
There are no reviews for Myosin Phosphatase 2 Antibody (NBP1-87750).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin Phosphatase 2 Antibody (NBP1-87750) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin Phosphatase 2 Products
Blogs on Myosin Phosphatase 2