Myosin Phosphatase 2 Antibody

Images

 
Western Blot: Myosin Phosphatase 2 Antibody [H00004660-B02P] - Analysis of PPP1R12B expression in transfected 293T cell line by PPP1R12B polyclonal antibody. Lane 1: PPP1R12B transfected lysate(42.46 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myosin Phosphatase 2 Antibody Summary

Immunogen
PPP1R12B (ENSP00000349206, 1 a.a. - 386 a.a.) full-length human protein. MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
Specificity
PPP1R12B - protein phosphatase 1, regulatory (inhibitor) subunit 12B,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPP1R12B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myosin Phosphatase 2 Antibody

  • MGC131980
  • MGC87886
  • Myosin phosphatase target subunit 2
  • myosin phosphatase, target subunit 2
  • Myosin phosphatase-targeting subunit 2
  • MYPT 2
  • MYPT2FLJ40942
  • protein phosphatase 1 regulatory subunit 12B
  • protein phosphatase 1, regulatory (inhibitor) subunit 12B

Background

Myosin light chain phosphatase (MLCP) consists of three subunits- catalytic subunit, large subunit/myosin binding subunit (MBS) and small subunit (sm-M20). This gene is a multi-functional gene which encodes both MBS and sm-M20. MLCP regulates myosins and the dephosphorylation is enhanced by the presence of MBS. The sm-M20 is suggested to play a regulatory role in muscle contraction by binding to MBS. MBS is also encoded by another gene, myosin light chain phosphatase target subunit 1. sm-M20 shows higher binding affinity to this gene product than to myosin light chain phosphatase target subunit 2-MBS even though the two MBS proteins are highly similar. Although both MBSs increase the activity of MLCP, myosin light chain phosphatase target subunit 1-MBS is a more efficient activator. There are four alternatively spliced transcript variants described; two alter the MBS coding region and two alter the sm-M20 coding region of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-38889
Species: Hu
Applications: WB, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00026051-D01P
Species: Hu
Applications: WB, ELISA
NLS1071
Species: Hu
Applications: IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82750
Species: Hu
Applications: WB, IHC, IHC-P
H00009426-R01
Species: Hu
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-52539
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00004660-B02P
Species: Hu
Applications: WB

Publications for Myosin Phosphatase 2 Antibody (H00004660-B02P) (0)

There are no publications for Myosin Phosphatase 2 Antibody (H00004660-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Phosphatase 2 Antibody (H00004660-B02P) (0)

There are no reviews for Myosin Phosphatase 2 Antibody (H00004660-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin Phosphatase 2 Antibody (H00004660-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Phosphatase 2 Products

Bioinformatics Tool for Myosin Phosphatase 2 Antibody (H00004660-B02P)

Discover related pathways, diseases and genes to Myosin Phosphatase 2 Antibody (H00004660-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Phosphatase 2 Antibody (H00004660-B02P)

Discover more about diseases related to Myosin Phosphatase 2 Antibody (H00004660-B02P).
 

Pathways for Myosin Phosphatase 2 Antibody (H00004660-B02P)

View related products by pathway.

PTMs for Myosin Phosphatase 2 Antibody (H00004660-B02P)

Learn more about PTMs related to Myosin Phosphatase 2 Antibody (H00004660-B02P).

Blogs on Myosin Phosphatase 2

There are no specific blogs for Myosin Phosphatase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Phosphatase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R12B
Entrez
Uniprot