Myosin light chain 3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin light chain 3. Source: E. coli Amino Acid Sequence: AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MYL3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57186.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Myosin light chain 3 Recombinant Protein Antigen
Background
Myosin light chain 3, or MYL3 for short, consists of a 195 amino acid isoform that is 22 kDa, and is involved in the regulation of Myosin, which is a protein that conducts ATP hydrolysis. Current research is being conducted on the relationship between Myosin light chain 3 and a multitude of diseases and disorders, including familial hypertrophic cardiomyopathy, congestive heart failure, restrictive cardiomyopathy, dilated cardiomyopathy, diabetes mellitus, and renal failure. Myosin light chain 3 has been linked to the RhoA pathway, as well as PKA signaling, growth cone motility, cell adhesion, cardiac muscle contraction, and cytoskeleton remodeling. The protein interacts with YWHAQ, MYH13, YWHAZ, MYH9, and MYH7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow, AP, IA, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Publications for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)
There are no publications for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)
There are no reviews for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)
Additional Myosin light chain 3 Products
Blogs on Myosin light chain 3