Myosin light chain 3 Recombinant Protein Antigen

Images

 
There are currently no images for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Myosin light chain 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin light chain 3.

Source: E. coli

Amino Acid Sequence: AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57186.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin light chain 3 Recombinant Protein Antigen

  • Cardiac myosin light chain 1
  • CMH8Ventricular/slow twitch myosin alkali light chain
  • CMLC1
  • light polypeptide 3, alkali; ventricular, skeletal, slow
  • MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform
  • MLC1V
  • myosin light chain 3
  • myosin, light chain 3, alkali; ventricular, skeletal, slow
  • VLC1

Background

Myosin light chain 3, or MYL3 for short, consists of a 195 amino acid isoform that is 22 kDa, and is involved in the regulation of Myosin, which is a protein that conducts ATP hydrolysis. Current research is being conducted on the relationship between Myosin light chain 3 and a multitude of diseases and disorders, including familial hypertrophic cardiomyopathy, congestive heart failure, restrictive cardiomyopathy, dilated cardiomyopathy, diabetes mellitus, and renal failure. Myosin light chain 3 has been linked to the RhoA pathway, as well as PKA signaling, growth cone motility, cell adhesion, cardiac muscle contraction, and cytoskeleton remodeling. The protein interacts with YWHAQ, MYH13, YWHAZ, MYH9, and MYH7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16433
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-30249
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
NB110-2546
Species: Hu, Mu
Applications: Flow, AP, IA, IHC,  IHC-P, IP, S-ELISA, WB
MAB9096
Species: Hu
Applications: IHC, WB
NBP1-33716
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-97725
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-13632
Species: Hu
Applications: IHC,  IHC-P
MAB1874
Species: Hu
Applications: ICC, IHC
NBP2-30954
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-62625
Species: Hu
Applications: IHC,  IHC-P
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-57186PEP
Species: Hu
Applications: AC

Publications for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)

There are no publications for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)

There are no reviews for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin light chain 3 Products

Blogs on Myosin light chain 3

There are no specific blogs for Myosin light chain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin light chain 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL3