Myosin Light Chain 2 Antibody (3B9-B4) [DyLight 405] (H00004633-M01V)

Images

 

Product Details

Summary
Product Discontinued
View other related Myosin Light Chain 2 Primary Antibodies

Order Details


    • Catalog Number
      H00004633-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Myosin Light Chain 2 Antibody (3B9-B4) [DyLight 405] Summary

Immunogen
MYL2 (AAH15821.1, 1 a.a. - 166 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Specificity
MYL2 - myosin, light polypeptide 2, regulatory, cardiac, slow
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myosin Light Chain 2 Antibody (3B9-B4) [DyLight 405]

  • cardiac ventricular myosin light chain 2
  • CMH10myosin light chain 2
  • DKFZp779C0562
  • MLC2
  • MLC-2
  • MLC-2v
  • myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  • myosin, light chain 2, regulatory, cardiac, slow
  • myosin, light polypeptide 2, regulatory, cardiac, slow
  • regulatory light chain of myosin
  • RLC of myosin
  • slow cardiac myosin regulatory light chain 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-98474
Species: Hu
Applications: WB

Publications for Myosin Light Chain 2 Antibody (H00004633-M01V) (0)

There are no publications for Myosin Light Chain 2 Antibody (H00004633-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Light Chain 2 Antibody (H00004633-M01V) (0)

There are no reviews for Myosin Light Chain 2 Antibody (H00004633-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin Light Chain 2 Antibody (H00004633-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Light Chain 2 Products

Related Products by Gene

Bioinformatics Tool for Myosin Light Chain 2 Antibody (H00004633-M01V)

Discover related pathways, diseases and genes to Myosin Light Chain 2 Antibody (H00004633-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Light Chain 2 Antibody (H00004633-M01V)

Discover more about diseases related to Myosin Light Chain 2 Antibody (H00004633-M01V).
 

Pathways for Myosin Light Chain 2 Antibody (H00004633-M01V)

View related products by pathway.

PTMs for Myosin Light Chain 2 Antibody (H00004633-M01V)

Learn more about PTMs related to Myosin Light Chain 2 Antibody (H00004633-M01V).
 

Research Areas for Myosin Light Chain 2 Antibody (H00004633-M01V)

Find related products by research area.

Blogs on Myosin Light Chain 2

There are no specific blogs for Myosin Light Chain 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Light Chain 2 Antibody (3B9-B4) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL2