Myosin-Id Antibody

Images

 
Western Blot: Myosin-Id Antibody [NBP2-30661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunocytochemistry/ Immunofluorescence: Myosin-Id Antibody [NBP2-30661] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Myosin-Id Antibody [NBP2-30661] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin-Id Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myosin-Id Protein (NBP2-30661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin-Id Antibody

  • KIAA0727myr4
  • myosin ID
  • myosin-I gamma
  • myosin-Id

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87739
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-31598
Species: Hu
Applications: IHC, IHC-P
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93704
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-45839
Species: Hu
Applications: WB, IHC, IF
NBP2-45496
Species: Hu
Applications: WB, IHC
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-30661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Myosin-Id Antibody (NBP2-30661) (0)

There are no publications for Myosin-Id Antibody (NBP2-30661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin-Id Antibody (NBP2-30661) (0)

There are no reviews for Myosin-Id Antibody (NBP2-30661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin-Id Antibody (NBP2-30661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin-Id Products

Bioinformatics Tool for Myosin-Id Antibody (NBP2-30661)

Discover related pathways, diseases and genes to Myosin-Id Antibody (NBP2-30661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin-Id Antibody (NBP2-30661)

Discover more about diseases related to Myosin-Id Antibody (NBP2-30661).
 

Pathways for Myosin-Id Antibody (NBP2-30661)

View related products by pathway.

PTMs for Myosin-Id Antibody (NBP2-30661)

Learn more about PTMs related to Myosin-Id Antibody (NBP2-30661).
 

Research Areas for Myosin-Id Antibody (NBP2-30661)

Find related products by research area.

Blogs on Myosin-Id

There are no specific blogs for Myosin-Id, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin-Id Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1D
Uniprot