Myoneurin Antibody (3E8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Myoneurin Primary Antibodies

Order Details


    • Catalog Number
      H00055892-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Myoneurin Antibody (3E8) [DyLight 488] Summary

Immunogen
MYNN (NP_061127, 501 a.a. ~ 611 a.a) partial recombinant protein with GST tag.CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQD SIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQS PTSDTLLRSTVNGYSEPQLIFLQQLY
Localization
Nuclear
Specificity
MYNN - myoneurin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYNN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myoneurin Antibody (3E8) [DyLight 488]

  • myoneurin
  • OSZF
  • ZBTB31SBBIZ1
  • Zinc finger and BTB domain-containing protein 31
  • zinc finger protein with BTB/POZ domain
  • ZNF902

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-836
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
H00055892-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Myoneurin Antibody (H00055892-M01G) (0)

There are no publications for Myoneurin Antibody (H00055892-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myoneurin Antibody (H00055892-M01G) (0)

There are no reviews for Myoneurin Antibody (H00055892-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myoneurin Antibody (H00055892-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myoneurin Products

Bioinformatics Tool for Myoneurin Antibody (H00055892-M01G)

Discover related pathways, diseases and genes to Myoneurin Antibody (H00055892-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myoneurin Antibody (H00055892-M01G)

Discover more about diseases related to Myoneurin Antibody (H00055892-M01G).
 

Pathways for Myoneurin Antibody (H00055892-M01G)

View related products by pathway.

Blogs on Myoneurin

There are no specific blogs for Myoneurin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myoneurin Antibody (3E8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol MYNN