Myogenin Antibody

Images

 
Western Blot: Myogenin Antibody [H00004656-D01P] - Analysis of MYOG expression in mouse lung.
Western Blot: Myogenin Antibody [H00004656-D01P] - Analysis of MYOG expression in transfected 293T cell line by MYOG polyclonal antibody.Lane 1: MYOG transfected lysate(25.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myogenin Antibody Summary

Immunogen
MYOG (NP_002470.2, 1 a.a. - 224 a.a.) full-length human protein. MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Specificity
Reacts with myogenin (myogenic factor 4).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myogenin Antibody

  • BHLHC3
  • bHLHc3Myogenic factor-4; myogenin
  • Class C basic helix-loop-helix protein 3
  • MYF4
  • myf-4
  • MYF4myogenin
  • MYOG
  • Myogenic factor 4
  • myogenin (myogenic factor 4)
  • Myogenin

Background

Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-13958
Species: Hu
Applications: IHC, IHC-P

Publications for Myogenin Antibody (H00004656-D01P) (0)

There are no publications for Myogenin Antibody (H00004656-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myogenin Antibody (H00004656-D01P) (0)

There are no reviews for Myogenin Antibody (H00004656-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myogenin Antibody (H00004656-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myogenin Products

Bioinformatics Tool for Myogenin Antibody (H00004656-D01P)

Discover related pathways, diseases and genes to Myogenin Antibody (H00004656-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myogenin Antibody (H00004656-D01P)

Discover more about diseases related to Myogenin Antibody (H00004656-D01P).
 

Pathways for Myogenin Antibody (H00004656-D01P)

View related products by pathway.

PTMs for Myogenin Antibody (H00004656-D01P)

Learn more about PTMs related to Myogenin Antibody (H00004656-D01P).
 

Research Areas for Myogenin Antibody (H00004656-D01P)

Find related products by research area.

Blogs on Myogenin

There are no specific blogs for Myogenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myogenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOG
Entrez
Uniprot