MYO15A Antibody

Images

 
Immunohistochemistry: MYO15A Antibody [NBP2-13635] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Product Discontinued
View other related MYO15A Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13635
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MYO15A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FPQPTQQIKNIVRQYQQPFRGGRPEALRKDGGKVFMKRPDPHEEALMILK GQMTHLAAAPGTQVSREAVALVKPVTSAPRPSMAPTSALPSRSLEPPEEL TQTRLHRLINPNFYGYQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO15A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP2-13635.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYO15A Antibody

  • DFNB3
  • DKFZp686N18198
  • FLJ17274
  • FLJ31311
  • MYO15
  • myosin XVA
  • myosin-XV
  • Unconventional myosin-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13636
Species: Hu
Applications: IHC, IHC-P
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
38160002
Species: Hu
Applications: WB, ELISA
NBP1-90588
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P

Publications for MYO15A Antibody (NBP2-13635)(1)

Reviews for MYO15A Antibody (NBP2-13635) (0)

There are no reviews for MYO15A Antibody (NBP2-13635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYO15A Antibody (NBP2-13635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYO15A Products

MYO15A NBP2-13635

Bioinformatics Tool for MYO15A Antibody (NBP2-13635)

Discover related pathways, diseases and genes to MYO15A Antibody (NBP2-13635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO15A Antibody (NBP2-13635)

Discover more about diseases related to MYO15A Antibody (NBP2-13635).
 

Pathways for MYO15A Antibody (NBP2-13635)

View related products by pathway.

Blogs on MYO15A

There are no specific blogs for MYO15A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYO15A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO15A