MYLK3 Antibody

Images

 
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP1-86648] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYLK3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYLK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 28364042).
Control Peptide
MYLK3 Protein (NBP1-86648PEP)
Publications
Read Publication using NBP1-86648.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYLK3 Antibody

  • caMLCK
  • Cardiac-MyBP-C-associated Ca/CaM kinase
  • EC 2.7.11
  • EC 2.7.11.18
  • MGC126319
  • MGC126320
  • MLC kinase
  • MLCK2
  • MLCKcardiac-MyBP-C associated Ca/CaM kinase
  • myosin light chain kinase 3
  • putative myosin light chain kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NSB624
Species: Hu, Mu, Rt, Ch, Dr, Fe, Pm, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF

Publications for MYLK3 Antibody (NBP1-86648)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for MYLK3 Antibody (NBP1-86648) (0)

There are no reviews for MYLK3 Antibody (NBP1-86648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYLK3 Antibody (NBP1-86648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYLK3 Products

Bioinformatics Tool for MYLK3 Antibody (NBP1-86648)

Discover related pathways, diseases and genes to MYLK3 Antibody (NBP1-86648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK3 Antibody (NBP1-86648)

Discover more about diseases related to MYLK3 Antibody (NBP1-86648).

PTMs for MYLK3 Antibody (NBP1-86648)

Learn more about PTMs related to MYLK3 Antibody (NBP1-86648).

Blogs on MYLK3

There are no specific blogs for MYLK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYLK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYLK3