Recombinant Human MYH16 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MYH16 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 396-495 of Human MYH16

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ASMETIQKSKMNAEAHVRKLEDSLSEANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSTAVVS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYH16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MYH16 GST (N-Term) Protein

  • FLJ22037
  • MHC20
  • MYH16P
  • MYH5
  • myosin, heavy chain 16 pseudogene
  • myosin, heavy chain 16
  • myosin, heavy polypeptide 16
  • myosin, heavy polypeptide 5

Background

The MYH16 gene, encoding a sarcomeric myosin heavy chain expressed in nonhuman primate masticatory muscles, is inactivated in humans. Stedman et al. (2004) [PubMed 15042088] hypothesized that the decrement in masticatory muscle size caused by the inactivation of MYH16 removed an evolutionary constraint on encephalization in early man.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP1-87894
Species: Hu
Applications: IHC, IHC-P
AF5647
Species: Hu, Mu
Applications: ICC, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00084176-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MYH16 Partial Recombinant Protein (H00084176-Q01) (0)

There are no publications for MYH16 Partial Recombinant Protein (H00084176-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYH16 Partial Recombinant Protein (H00084176-Q01) (0)

There are no reviews for MYH16 Partial Recombinant Protein (H00084176-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYH16 Partial Recombinant Protein (H00084176-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYH16 Products

Array H00084176-Q01

Bioinformatics Tool for MYH16 Partial Recombinant Protein (H00084176-Q01)

Discover related pathways, diseases and genes to MYH16 Partial Recombinant Protein (H00084176-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYH16 Partial Recombinant Protein (H00084176-Q01)

Discover more about diseases related to MYH16 Partial Recombinant Protein (H00084176-Q01).
 

Pathways for MYH16 Partial Recombinant Protein (H00084176-Q01)

View related products by pathway.

Blogs on MYH16

There are no specific blogs for MYH16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MYH16 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH16