MyD88 Antibody

Images

 
Western Blot: MyD88 Antibody [H00004615-D01P] - Analysis of MYD88 expression in rat spleen.
Immunocytochemistry/ Immunofluorescence: MyD88 Antibody [H00004615-D01P] - Analysis of antibody to MYD88 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: MyD88 Antibody [H00004615-D01P] - Analysis of MYD88 expression in transfected 293T cell line by MYD88 polyclonal antibody.Lane 1: MYD88 transfected lysate(33.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MyD88 Antibody Summary

Immunogen
MYD88 (NP_002459.1, 1 a.a. - 296 a.a.) full-length human protein. MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Specificity
Reacts with myeloid differentiation primary response gene (88).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYD88
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.
Antagonist

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MyD88 Antibody

  • MyD88
  • MYD88D
  • myeloid differentiation primary response gene (88)
  • myeloid differentiation primary response protein MyD88

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-26506
Species: Hu, Mu, Rt
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
H00004615-D01P
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for MyD88 Antibody (H00004615-D01P) (0)

There are no publications for MyD88 Antibody (H00004615-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MyD88 Antibody (H00004615-D01P) (0)

There are no reviews for MyD88 Antibody (H00004615-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MyD88 Antibody (H00004615-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MyD88 Products

Bioinformatics Tool for MyD88 Antibody (H00004615-D01P)

Discover related pathways, diseases and genes to MyD88 Antibody (H00004615-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MyD88 Antibody (H00004615-D01P)

Discover more about diseases related to MyD88 Antibody (H00004615-D01P).
 

Pathways for MyD88 Antibody (H00004615-D01P)

View related products by pathway.

PTMs for MyD88 Antibody (H00004615-D01P)

Learn more about PTMs related to MyD88 Antibody (H00004615-D01P).

Blogs on MyD88.

The role of STING/TMEM173 in gamma and encephalitis Herpes Simplex Virus (HSV)
Stimulator of interferon genes (STING), also known as TMEM173, promotes the production of the interferon’s IFN-alpha and IFN-beta.  STING possesses three functional domains: a cytoplasmic C-terminal tail, a central globular domain, and four N-...  Read full blog post.

TRIF/TICAM1 and mitochondrial dynamics in the innate immune response
TRIF, also known as toll like receptor adaptor molecule 1 or TICAM1, is known for its role in invading foreign pathogens as part of our innate immune response. TRIF/TICAM1 is a TIR-domain adaptor protein (toll/interleukin-1 receptor) that interacts...  Read full blog post.

The role of TLR4 in breast cancer
Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation.  In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy...  Read full blog post.

MYD88 Expression and Tumorigenesis
MyD88, also called myeloid differentiation primary response gene 88, encodes a cytosolic adapter protein that plays an essential role in innate and adaptive immune responses. The innate immune system recognizes the presence of bacterial pathogens thro...  Read full blog post.

TLR7 and Immune Response Regulation
Toll-like receptor 7 (TLR7) is a protein encoded by the TLR7 gene in humans and is a member of TLR family. TLRs controls host immune response against pathogens (e.g. viruses, bacteria and fungi) through recognition of pathogen-associated molecular pat...  Read full blog post.

MYD88: Fanning Inflammation and Immune Responses
Myeloid differentiation primary response gene 88 (MYD88) encodes a cytosolic adapter protein that plays an essential role in innate and adaptive immune responses. MYD88 protein functions as an essential signal transducer in the interleukin-1 and in To...  Read full blog post.

MyD88 Antibodies for IL Signaling and Immunity Research
The myeloid differentiation protein MyD88 (myeloid differentiation primary response protein) was originally identified and characterized as a primary upregulated response gene in interleukin-6 mediated myeloid differentiation. Now, MyD88 is known to b...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MyD88 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYD88
Entrez
Uniprot