MXRA8/DICAM Antibody


Western Blot: MXRA8/DICAM Antibody [NBP2-30499] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2
Immunohistochemistry-Paraffin: MXRA8/DICAM Antibody [NBP2-30499] - Staining of human urinary bladder shows strong nucleolar positivity in urothelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MXRA8/DICAM Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GLYTCNLHHHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQ
Specificity of human MXRA8/DICAM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MXRA8/DICAM Protein (NBP2-30499PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MXRA8/DICAM Antibody

  • Asp3
  • Limitrin
  • Matrix-Remodeling-Associated Protein 8
  • MXRA8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Mu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MXRA8/DICAM Antibody (NBP2-30499) (0)

There are no publications for MXRA8/DICAM Antibody (NBP2-30499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MXRA8/DICAM Antibody (NBP2-30499) (0)

There are no reviews for MXRA8/DICAM Antibody (NBP2-30499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MXRA8/DICAM Antibody (NBP2-30499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MXRA8/DICAM Products

Bioinformatics Tool for MXRA8/DICAM Antibody (NBP2-30499)

Discover related pathways, diseases and genes to MXRA8/DICAM Antibody (NBP2-30499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MXRA8/DICAM Antibody (NBP2-30499)

Discover more about diseases related to MXRA8/DICAM Antibody (NBP2-30499).

Pathways for MXRA8/DICAM Antibody (NBP2-30499)

View related products by pathway.

PTMs for MXRA8/DICAM Antibody (NBP2-30499)

Learn more about PTMs related to MXRA8/DICAM Antibody (NBP2-30499).

Blogs on MXRA8/DICAM

There are no specific blogs for MXRA8/DICAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MXRA8/DICAM Antibody and receive a gift card or discount.


Gene Symbol MXRA8