MVD Antibody (2A7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MVD Primary Antibodies

Order Details


    • Catalog Number
      H00004597-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MVD Antibody (2A7) [PE] Summary

Immunogen
MVD (NP_002452 301 a.a. - 398 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKP
Specificity
MVD - mevalonate (diphospho) decarboxylase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MVD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MVD Antibody (2A7) [PE]

  • EC 4.1.1.33
  • FP17780
  • MDDase
  • mevalonate (diphospho) decarboxylase
  • Mevalonate (diphospho)decarboxylase
  • Mevalonate pyrophosphate decarboxylase
  • MPDdiphosphomevalonate decarboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00004597-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MVD Antibody (H00004597-M01PE) (0)

There are no publications for MVD Antibody (H00004597-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVD Antibody (H00004597-M01PE) (0)

There are no reviews for MVD Antibody (H00004597-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MVD Antibody (H00004597-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MVD Products

Bioinformatics Tool for MVD Antibody (H00004597-M01PE)

Discover related pathways, diseases and genes to MVD Antibody (H00004597-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVD Antibody (H00004597-M01PE)

Discover more about diseases related to MVD Antibody (H00004597-M01PE).
 

Pathways for MVD Antibody (H00004597-M01PE)

View related products by pathway.

PTMs for MVD Antibody (H00004597-M01PE)

Learn more about PTMs related to MVD Antibody (H00004597-M01PE).
 

Research Areas for MVD Antibody (H00004597-M01PE)

Find related products by research area.

Blogs on MVD

There are no specific blogs for MVD, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MVD Antibody (2A7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MVD