MUTED Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MUTED Antibody [NBP2-57880] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Product Discontinued
View other related MUTED Primary Antibodies

Order Details


    • Catalog Number
      NBP2-57880
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MUTED Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLE
Specificity
Specificity of human MUTED antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLOC1S5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MUTED Antibody

  • DKFZp686E2287
  • FLJ18427
  • MUdJ303A1.3
  • muted homolog (mouse)
  • protein Muted homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
H00008706-P01
Species: Hu
NBP2-65621
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-57880
Species: Hu, Rt
Applications: ICC/IF

Publications for MUTED Antibody (NBP2-57880) (0)

There are no publications for MUTED Antibody (NBP2-57880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUTED Antibody (NBP2-57880) (0)

There are no reviews for MUTED Antibody (NBP2-57880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MUTED Antibody (NBP2-57880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUTED Products

Bioinformatics Tool for MUTED Antibody (NBP2-57880)

Discover related pathways, diseases and genes to MUTED Antibody (NBP2-57880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MUTED

There are no specific blogs for MUTED, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUTED Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLOC1S5