Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human Muscarinic Acetylcholine Receptor M5/CHRM5 (NP_036257.1). RRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CHRM5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free
Background
Muscarinic cholinergic receptor M5 is an Acetylcholine Receptor that is active during embryonic development. It is coupled to phosphoinositide degradation and to the activation of mitogen-activated protein kinase (MAPK). The M5 receptor has been reported to be expressed in blood, brain, and ovary. ESTs have been isolated from human testis and placenta libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Bv, Eq, Gp, Ha, Hu, Po, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150) (0)
There are no publications for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150) (0)
There are no reviews for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Muscarinic Acetylcholine Receptor M5/CHRM5 Products
Research Areas for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP2-94150)
Find related products by research area.
|
Blogs on Muscarinic Acetylcholine Receptor M5/CHRM5