Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody


Immunohistochemistry: Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody [NBP1-87578] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Muscarinic Acetylcholine Receptor M5/CHRM5 Protein (NBP1-87578PEP)
Read Publication using
NBP1-87578 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%). Human reactivity reported in scientific literature (PMID: 24658304).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody

  • cholinergic receptor, muscarinic 5
  • CHRM5
  • HM5
  • M5
  • M5R
  • mAChR M5
  • MGC41838
  • muscarinic acetylcholine receptor M5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
Species: Hu, Rt, Po, Bv, Eq, GP, Ha
Applications: IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB
Species: Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P

Publications for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578) (0)

There are no reviews for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Muscarinic Acetylcholine Receptor M5/CHRM5 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578).

Pathways for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)

View related products by pathway.

Research Areas for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M5/CHRM5

There are no specific blogs for Muscarinic Acetylcholine Receptor M5/CHRM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody and receive a gift card or discount.


Gene Symbol CHRM5