![Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody [NBP1-87578] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Muscarinic-Acetylcholine-Receptor-M5-CHRM5-Antibody-Immunohistochemistry-Paraffin-NBP1-87578-img0003.jpg "Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody [NBP1-87578] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody - BSA Free (NBP1-87578) is a polyclonal antibody validated for use in IHC and WB. Anti-Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHRM5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC, WB reported in scientific literature (PMID: 24658304). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Flow Cytometry Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [Unconjugated]](https://images.novusbio.com/images2/CHRM3_MAB6378_Flow_Cytometry_24142.jpg)
![Immunohistochemistry Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [Unconjugated]](https://images.novusbio.com/images2/mab6378_human-chrm3-mab-clone-580011-immunohistochemistry-352020175913.jpg)
| Publication using NBP1-87578 | Applications | Species |
|---|---|---|
| Molina J, Rodriguez-Diaz R, Fachado A et al. Control of Insulin Secretion by Cholinergic Signaling in the Human Pancreatic Islet. Diabetes 2014-08-01 [PMID: 24658304] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody (NBP1-87578)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHRM5 |
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")