Musashi-2 Antibody


Western Blot: Musashi-2 Antibody [NBP1-70645] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration:2.5ug/mL, Peptide Concentration: 2.0ug/mL, more
Immunohistochemistry-Paraffin: Musashi-2 Antibody [NBP1-70645] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.
Western Blot: Musashi-2 Antibody [NBP1-70645] - K562 cells lysate at 1:1000.
Western Blot: Musashi-2 Antibody [NBP1-70645] - K563, Antibody Titration: 1.25ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Musashi-2 Antibody Summary

Synthetic peptides corresponding to MSI2 (musashi homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of MSI2. Peptide sequence LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Musashi-2 Antibody

  • FLJ36569
  • MGC3245
  • MSI2
  • MSI2H
  • musashi homolog 2 (Drosophila)
  • Musashi2
  • Musashi-2
  • RNA-binding protein Musashi homolog 2


MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Rt
Applications: ELISA, S-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Musashi-2 Antibody (NBP1-70645) (0)

There are no publications for Musashi-2 Antibody (NBP1-70645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Musashi-2 Antibody (NBP1-70645) (0)

There are no reviews for Musashi-2 Antibody (NBP1-70645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Musashi-2 Antibody (NBP1-70645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Musashi-2 Products

Bioinformatics Tool for Musashi-2 Antibody (NBP1-70645)

Discover related pathways, diseases and genes to Musashi-2 Antibody (NBP1-70645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Musashi-2 Antibody (NBP1-70645)

Discover more about diseases related to Musashi-2 Antibody (NBP1-70645).

Pathways for Musashi-2 Antibody (NBP1-70645)

View related products by pathway.

Research Areas for Musashi-2 Antibody (NBP1-70645)

Find related products by research area.

Blogs on Musashi-2

There are no specific blogs for Musashi-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Musashi-2 Antibody and receive a gift card or discount.


Gene Symbol MSI2