Musashi-2 Antibody

Images

 
Western Blot: Musashi-2 Antibody [NBP1-70645] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration:2.5ug/mL, Peptide Concentration: 2.0ug/mL, ...read more
Immunohistochemistry-Paraffin: Musashi-2 Antibody [NBP1-70645] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.
Western Blot: Musashi-2 Antibody [NBP1-70645] - K562 cells lysate at 1:1000.
Western Blot: Musashi-2 Antibody [NBP1-70645] - K563, Antibody Titration: 1.25ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Musashi-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MSI2 (musashi homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of MSI2. Peptide sequence LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSI2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Musashi-2 Antibody

  • FLJ36569
  • MGC3245
  • MSI2
  • MSI2H
  • musashi homolog 2 (Drosophila)
  • Musashi2
  • Musashi-2
  • RNA-binding protein Musashi homolog 2

Background

MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1759
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-73013
Species: Rt
Applications: ELISA, S-ELISA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70645
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Musashi-2 Antibody (NBP1-70645) (0)

There are no publications for Musashi-2 Antibody (NBP1-70645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Musashi-2 Antibody (NBP1-70645) (0)

There are no reviews for Musashi-2 Antibody (NBP1-70645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Musashi-2 Antibody (NBP1-70645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Musashi-2 Products

Bioinformatics Tool for Musashi-2 Antibody (NBP1-70645)

Discover related pathways, diseases and genes to Musashi-2 Antibody (NBP1-70645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Musashi-2 Antibody (NBP1-70645)

Discover more about diseases related to Musashi-2 Antibody (NBP1-70645).
 

Pathways for Musashi-2 Antibody (NBP1-70645)

View related products by pathway.

Research Areas for Musashi-2 Antibody (NBP1-70645)

Find related products by research area.

Blogs on Musashi-2

There are no specific blogs for Musashi-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Musashi-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSI2
Entrez