Mucin 5B Partial Protein

Images

 
There are currently no images for Mucin 5B Partial Recombinant Protein (H00727897-Q01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Mucin 5B Partial Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 4186 - 4295 of Human MUC5B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Protein/Peptide Type
Partial Protein
Gene
MUC5B

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00727897-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mucin 5B Partial Protein

  • high molecular weight salivary mucin MG1
  • mucin 5, subtype B, tracheobronchial
  • mucin 5B, oligomeric mucus/gel-forming
  • sublingual gland mucin
  • tracheobronchial

Background

MUC5B - mucin 5, subtype B, tracheobronchial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00727897-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Mucin 5B Partial Recombinant Protein (H00727897-Q01)(1)

Reviews for Mucin 5B Partial Recombinant Protein (H00727897-Q01) (0)

There are no reviews for Mucin 5B Partial Recombinant Protein (H00727897-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mucin 5B Partial Recombinant Protein (H00727897-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I recently bought several recombinant human mucins from your company, Mucin 4--cat# H00004585-Q01, mucin 5b--cat# H00727897-Q01, mucin 5ac--cat # H00004586-Q01. I would like to know what cell lines were used to make these recombinant proteins and whether they are glycosylated.
    • The proteins you inquired about were produced in the wheat germ protein expression system which is a cell free protein synthesis system. This system does not allow protein glycosylation. Please view more details about Abnova's cell free protein synthesis system.
  2. I'm interested in your company's product this human recombinant MUC5b protein. 1) Did you artificially make this from bacteria like something? 2) Your data sheet mentioned that this protein is not useful to measure activity. Is this protein composed by only core protein or is this product have glycocilation area?
    • This product is distributed by us for a Taiwanese company called Abnova. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-translational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody.

Additional Mucin 5B Products

Bioinformatics Tool for Mucin 5B Partial Recombinant Protein (H00727897-Q01)

Discover related pathways, diseases and genes to Mucin 5B Partial Recombinant Protein (H00727897-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mucin 5B Partial Recombinant Protein (H00727897-Q01)

Discover more about diseases related to Mucin 5B Partial Recombinant Protein (H00727897-Q01).
 

Pathways for Mucin 5B Partial Recombinant Protein (H00727897-Q01)

View related products by pathway.

PTMs for Mucin 5B Partial Recombinant Protein (H00727897-Q01)

Learn more about PTMs related to Mucin 5B Partial Recombinant Protein (H00727897-Q01).

Blogs on Mucin 5B

There are no specific blogs for Mucin 5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mucin 5B Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5B