Recombinant Human Mucin 5AC Protein

Images

 
Recombinant Human Mucin 5AC Protein [H00004586-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Mucin 5AC Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 351 - 450 of Human MUC5AC partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Protein/Peptide Type
Partial Recombinant Protein
Gene
MUC5AC

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using
H00004586-Q01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
No additives

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mucin 5AC Protein

  • gastric mucin
  • leB
  • lewis B blood group antigen
  • major airway glycoprotein
  • MUC5
  • mucin 5, subtypes A and C, tracheobronchial/gastric
  • mucin 5AC, oligomeric mucus/gel-forming pseudogene
  • mucin 5AC, oligomeric mucus/gel-forming
  • mucin-5 subtype AC, tracheobronchial
  • mucin-5AC
  • TBM
  • tracheobronchial mucin

Background

MUC5AC - mucin 5, subtypes A and C, tracheobronchial/gastric

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
H00004586-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Mucin 5AC Partial Recombinant Protein (H00004586-Q01) (0)

There are no reviews for Mucin 5AC Partial Recombinant Protein (H00004586-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mucin 5AC Partial Recombinant Protein (H00004586-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I recently bought several recombinant human mucins from your company, Mucin 4--cat# H00004585-Q01, mucin 5b--cat# H00727897-Q01, mucin 5ac--cat # H00004586-Q01. I would like to know what cell lines were used to make these recombinant proteins and whether they are glycosylated.
    • The proteins you inquired about were produced in the wheat germ protein expression system which is a cell free protein synthesis system. This system does not allow protein glycosylation. Please view more details about Abnova's cell free protein synthesis system.

Additional Mucin 5AC Products

Bioinformatics Tool for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)

Discover related pathways, diseases and genes to Mucin 5AC Partial Recombinant Protein (H00004586-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)

Discover more about diseases related to Mucin 5AC Partial Recombinant Protein (H00004586-Q01).
 

Pathways for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)

View related products by pathway.

PTMs for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)

Learn more about PTMs related to Mucin 5AC Partial Recombinant Protein (H00004586-Q01).
 

Research Areas for Mucin 5AC Partial Recombinant Protein (H00004586-Q01)

Find related products by research area.

Blogs on Mucin 5AC

There are no specific blogs for Mucin 5AC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mucin 5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mucin 5AC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5AC