Mucin 5AC Antibody

Images

 
Immunohistochemistry: Mucin 5AC Antibody [NBP2-31986] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mucin 5AC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC5AC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mucin 5AC Protein (NBP2-31986PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mucin 5AC Antibody

  • gastric mucin
  • leB
  • lewis B blood group antigen
  • major airway glycoprotein
  • MUC5
  • mucin 5, subtypes A and C, tracheobronchial/gastric
  • mucin 5AC, oligomeric mucus/gel-forming pseudogene
  • mucin 5AC, oligomeric mucus/gel-forming
  • mucin-5 subtype AC, tracheobronchial
  • mucin-5AC
  • TBM
  • tracheobronchial mucin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NBP2-31986
Species: Hu
Applications: IHC, IHC-P

Publications for Mucin 5AC Antibody (NBP2-31986) (0)

There are no publications for Mucin 5AC Antibody (NBP2-31986).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mucin 5AC Antibody (NBP2-31986) (0)

There are no reviews for Mucin 5AC Antibody (NBP2-31986). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mucin 5AC Antibody (NBP2-31986) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mucin 5AC Products

Bioinformatics Tool for Mucin 5AC Antibody (NBP2-31986)

Discover related pathways, diseases and genes to Mucin 5AC Antibody (NBP2-31986). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mucin 5AC Antibody (NBP2-31986)

Discover more about diseases related to Mucin 5AC Antibody (NBP2-31986).
 

Pathways for Mucin 5AC Antibody (NBP2-31986)

View related products by pathway.

PTMs for Mucin 5AC Antibody (NBP2-31986)

Learn more about PTMs related to Mucin 5AC Antibody (NBP2-31986).
 

Research Areas for Mucin 5AC Antibody (NBP2-31986)

Find related products by research area.

Blogs on Mucin 5AC

There are no specific blogs for Mucin 5AC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mucin 5AC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5AC
Uniprot