Mucin 5AC Antibody (2A4)

Images

 
Sandwich ELISA: Mucin 5AC Antibody (2A4) [H00004586-M04] - Detection limit for recombinant GST tagged MUC5AC is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mucin 5AC Antibody (2A4) Summary

Immunogen
MUC5AC (XP_495860, 351 a.a. - 450 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUC5AC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mucin 5AC Antibody (2A4)

  • gastric mucin
  • leB
  • lewis B blood group antigen
  • major airway glycoprotein
  • MUC5
  • mucin 5, subtypes A and C, tracheobronchial/gastric
  • mucin 5AC, oligomeric mucus/gel-forming pseudogene
  • mucin 5AC, oligomeric mucus/gel-forming
  • mucin-5 subtype AC, tracheobronchial
  • mucin-5AC
  • TBM
  • tracheobronchial mucin

Background

Mucins are high molecular weight glycoproteins with 80% carbohydrates and 20% core protein. Gastric mucin M1 antigen is found in columnar mucus cells of surface gastric epithelium and in goblet cells of the fetal and precancerous colon but not in normal colon. Resurgence of gastric mucin during colonic carcinogenesis is suggestive of either re-expression of the peptide core of gastric mucin in the adult colon or due to changes in the glycosylation pattern of mucin, which expose the hidden M1 antigen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
H00004586-M04
Species: Hu
Applications: WB, ELISA

Publications for Mucin 5AC Antibody (H00004586-M04) (0)

There are no publications for Mucin 5AC Antibody (H00004586-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mucin 5AC Antibody (H00004586-M04) (0)

There are no reviews for Mucin 5AC Antibody (H00004586-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mucin 5AC Antibody (H00004586-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mucin 5AC Products

Bioinformatics Tool for Mucin 5AC Antibody (H00004586-M04)

Discover related pathways, diseases and genes to Mucin 5AC Antibody (H00004586-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mucin 5AC Antibody (H00004586-M04)

Discover more about diseases related to Mucin 5AC Antibody (H00004586-M04).
 

Pathways for Mucin 5AC Antibody (H00004586-M04)

View related products by pathway.

PTMs for Mucin 5AC Antibody (H00004586-M04)

Learn more about PTMs related to Mucin 5AC Antibody (H00004586-M04).
 

Research Areas for Mucin 5AC Antibody (H00004586-M04)

Find related products by research area.

Blogs on Mucin 5AC

There are no specific blogs for Mucin 5AC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mucin 5AC Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC5AC