MUC2 Antibody (3A9)

Images

 

Product Details

Summary
Product Discontinued
View other related MUC2 Primary Antibodies

Order Details


    • Catalog Number
      H00004583-M06
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MUC2 Antibody (3A9) Summary

Immunogen
MUC2 (NP_002448 5081 a.a. - 5179 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Specificity
MUC2 (3A9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC2 Antibody (3A9)

  • Intestinal mucin-2
  • MLP
  • MUC-2
  • mucin 2, intestinal/tracheal
  • mucin 2, oligomeric mucus/gel-forming
  • mucin-2
  • mucin-like protein
  • SMUC

Background

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00004583-M06
Species: Hu
Applications: ELISA

Publications for MUC2 Antibody (H00004583-M06) (0)

There are no publications for MUC2 Antibody (H00004583-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC2 Antibody (H00004583-M06) (0)

There are no reviews for MUC2 Antibody (H00004583-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUC2 Antibody (H00004583-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC2 Products

MUC2 H00004583-M06

Bioinformatics Tool for MUC2 Antibody (H00004583-M06)

Discover related pathways, diseases and genes to MUC2 Antibody (H00004583-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC2 Antibody (H00004583-M06)

Discover more about diseases related to MUC2 Antibody (H00004583-M06).
 

Pathways for MUC2 Antibody (H00004583-M06)

View related products by pathway.

PTMs for MUC2 Antibody (H00004583-M06)

Learn more about PTMs related to MUC2 Antibody (H00004583-M06).

Blogs on MUC2

There are no specific blogs for MUC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC2 Antibody (3A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC2
Entrez
OMIM
Uniprot