MUC-1 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

MUC-1 Partial Recombinant Protein Summary

Description
MUC-1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
MUC1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00004582-Q01.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC-1 Partial Recombinant Protein

  • Breast carcinoma-associated antigen DF3
  • Carcinoma-associated mucin
  • CD227 antigen
  • CD227
  • DF3 antigen
  • EMA
  • Episialin
  • H23 antigen
  • H23AG
  • KL-6
  • MAM6
  • MUC-1
  • MUC1/ZD
  • mucin 1, cell surface associated
  • mucin 1, transmembrane
  • Mucin-1
  • Peanut-reactive urinary mucin
  • PEM
  • PEMMUC-1/SEC
  • PEMT
  • Polymorphic epithelial mucin
  • PUMMUC-1/X
  • tumor associated epithelial mucin
  • Tumor-associated epithelial membrane antigen
  • Tumor-associated mucin

Background

This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44376
Species: Hu, Rt(-)
Applications: WB, Flow, IHC-P, IF
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00004582-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MUC-1 Partial Recombinant Protein (H00004582-Q01)(3)


Reviews for MUC-1 Partial Recombinant Protein (H00004582-Q01) (0)

There are no reviews for MUC-1 Partial Recombinant Protein (H00004582-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC-1 Partial Recombinant Protein (H00004582-Q01). (Showing 1 - 3 of 3 FAQs).

  1. I would like to perform a sandwich assay for the determination of MUC1 protein. May you suggest me some antibodies that can be used together? In particular, if possible, I should need antibodies product in mouse or rabbit.
    • Unfortunately we are not aware of a pair of antibodies that have been used in sandwich ELISA in particular. If you are interested in trying two you may find our Innovators Reward Program to be helpful.
  2. I am interested in purchasing MUC1 protein from you and it would be a great help if you could answer a few of my questions. 1) How much of the glycoprotein is glycosylated? 2) Is it soluble in water? 3) It says on the website that the product is not active, what exactly do you mean by that?
    • This protein is a recombinant protein. It does not undergo glycosylation. It may not be folded in the same way as the native protein therefore it may be not act in the same way. This should only be used for WB and as a positive control in ELISA. It is soluble in water.
  3. Could you recommend us a protocol for ELISA test in a sandwich format for MUC1 protein catalog # H00004582-Q01 using catalog # NB100-65647 as primary antibody and catalog # NBP1-61561 as secondary with a third labeled antibody? Regarding the request below with that pair of antibodies and that recombinant protein: could you help us with another primary monoclonal antibody to replace the NB100-65647 antibody with it, so we could use it in a sandwich assay with the protein H00004582-Q01 and the NBP1-61561. Thank you. Also do you know if this recombinant protein is tumoral MUC1 or normal MUC1, because they have different structures.
    • Unfortunately, the antibody and protein combination you have chosen will not work. As is stated in our datasheet for NB100-65647 The dominant epitope recognized by this antibody is the 12-mer GVTSAPDTRPAP. Unfortunately, this epitope is not present in the partial recombinant protein H00004582-Q01. While NB100-65647 and NBP1-61561 are suitable pairs to use for ELISA, H00004582-Q01 is not a suitable standard for use with this pair, and unfortunately it does not look like we carry a suitable standard for you. I apologize for the inconvenience. Please see our ELISA protocol. H00004582-Q01 is produced by a Taiwanese company called Abnova and we distribute it for them. It is produced in their cell-free wheat germ expression system. I would recommend using one of Abnova's matched antibody pairs for use in ELISA if you are going to use H00004582-Q01 as a standard. I would recommend using the H00004582-AP41 antibody pair.

Additional MUC-1 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for MUC-1 Partial Recombinant Protein (H00004582-Q01)

Discover related pathways, diseases and genes to MUC-1 Partial Recombinant Protein (H00004582-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC-1 Partial Recombinant Protein (H00004582-Q01)

Discover more about diseases related to MUC-1 Partial Recombinant Protein (H00004582-Q01).
 

Pathways for MUC-1 Partial Recombinant Protein (H00004582-Q01)

View related products by pathway.

PTMs for MUC-1 Partial Recombinant Protein (H00004582-Q01)

Learn more about PTMs related to MUC-1 Partial Recombinant Protein (H00004582-Q01).
 

Research Areas for MUC-1 Partial Recombinant Protein (H00004582-Q01)

Find related products by research area.

Blogs on MUC-1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Mucin 1 - a mucosal epithelial glycoprotein with importance in cancer diagnostics
Mucin 1 (Muc1) is a heavily glycosylated protein that coats mucosal epithelial cells of the lungs, intestines, and other organs. Muc1 is thought to protect cells by binding to pathogens and responding to infections. During trafficking to the plasma...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MUC1
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00004582-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046