MUC-1 Antibody


Western Blot: MUC-1 Antibody [NBP1-60046] - Total protein from mouse 3T3 cells and human HeLa cells, stomach and colon was separated on a 4-15% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat more
Immunocytochemistry/ Immunofluorescence: MUC-1 Antibody [NBP1-60046] - MUC1 antibody (NBP1-60046) was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Cells were counterstained for alpha-tubulin more
Immunohistochemistry-Paraffin: MUC1 Antibody [NBP1-60046] - Human kidney lysate tissue at an antibody concentration of 4-8ug/ml.
Immunohistochemistry-Paraffin: MUC1 Antibody [NBP1-60046] - Pig stomach.
Immunohistochemistry-Paraffin: MUC1 Antibody [NBP1-60046] - Pig stomach.
Immunohistochemistry-Paraffin: MUC1 Antibody [NBP1-60046] - Human stomach.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Eq, GP, Gt, RbSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
1.0 mg/ml

MUC-1 Antibody Summary

Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MUC-1 Lysate (NBP2-66149)
Read Publications using NBP1-60046.

Reactivity Notes

Goat reactivity reported in scientific literature (PMID: 28740504), Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
0.02% Sodium Azide
1.0 mg/ml
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MUC-1 Antibody

  • Breast carcinoma-associated antigen DF3
  • Carcinoma-associated mucin
  • CD227 antigen
  • CD227
  • DF3 antigen
  • EMA
  • Episialin
  • H23 antigen
  • H23AG
  • KL-6
  • MAM6
  • MUC-1
  • MUC1/ZD
  • mucin 1, cell surface associated
  • mucin 1, transmembrane
  • Mucin-1
  • Peanut-reactive urinary mucin
  • PEM
  • PEMT
  • Polymorphic epithelial mucin
  • PUMMUC-1/X
  • tumor associated epithelial mucin
  • Tumor-associated epithelial membrane antigen
  • Tumor-associated mucin


MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, IHC-P, IF
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Gt, Rb
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MUC-1 Antibody (NBP1-60046)(2)

Reviews for MUC-1 Antibody (NBP1-60046) (0)

There are no reviews for MUC-1 Antibody (NBP1-60046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MUC-1 Antibody (NBP1-60046). (Showing 1 - 1 of 1 FAQs).

  1. I would like to perform a sandwich assay for the determination of MUC1 protein. May you suggest me some antibodies that can be used together? In particular, if possible, I should need antibodies product in mouse or rabbit.
    • Unfortunately we are not aware of a pair of antibodies that have been used in sandwich ELISA in particular. If you are interested in trying two you may find our Innovators Reward Program to be helpful.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Alexa Fluor 488 Labeled NBP1-60046AF488
Alexa Fluor 647 Labeled NBP1-60046AF647
Biotin Labeled NBP1-60046B
DyLight 350 Labeled NBP1-60046UV
DyLight 405 Labeled NBP1-60046V
DyLight 488 Labeled NBP1-60046G
DyLight 550 Labeled NBP1-60046R
DyLight 650 Labeled NBP1-60046C
DyLight 680 Labeled NBP1-60046FR
DyLight 755 Labeled NBP1-60046IR
HRP Labeled NBP1-60046H

Additional Array Products

Bioinformatics Tool for MUC-1 Antibody (NBP1-60046)

Discover related pathways, diseases and genes to MUC-1 Antibody (NBP1-60046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC-1 Antibody (NBP1-60046)

Discover more about diseases related to MUC-1 Antibody (NBP1-60046).

Pathways for MUC-1 Antibody (NBP1-60046)

View related products by pathway.

PTMs for MUC-1 Antibody (NBP1-60046)

Learn more about PTMs related to MUC-1 Antibody (NBP1-60046).

Research Areas for MUC-1 Antibody (NBP1-60046)

Find related products by research area.

Blogs on MUC-1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Mucin 1 - a mucosal epithelial glycoprotein with importance in cancer diagnostics
Mucin 1 (Muc1) is a heavily glycosylated protein that coats mucosal epithelial cells of the lungs, intestines, and other organs. Muc1 is thought to protect cells by binding to pathogens and responding to infections. During trafficking to the plasma...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MUC-1 Antibody and receive a gift card or discount.


Gene Symbol MUC1