mu Crystallin Antibody

Images

 
Western Blot: mu Crystallin Antibody [NBP1-52867] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related mu Crystallin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52867
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

mu Crystallin Antibody Summary

Immunogen
Synthetic peptides corresponding to CRYM(crystallin, mu) The peptide sequence was selected from the middle region of CRYM. Peptide sequence AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA.
Clonality
Polyclonal
Host
Rabbit
Gene
CRYM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CRYM and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for mu Crystallin Antibody

  • crystallin, mu
  • DFNA40NADP-regulated thyroid-hormone binding protein
  • mu-crystallin homolog
  • NADP-regulated thyroid-hormone-binding protein
  • THBP

Background

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. Multiple alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83419
Species: Hu
Applications: IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-57033
Species: Hu
Applications: WB
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4235
Species: Hu, Mu
Applications: WB
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-91915
Species: Hu
Applications: WB, IHC, IHC-P

Publications for mu Crystallin Antibody (NBP1-52867) (0)

There are no publications for mu Crystallin Antibody (NBP1-52867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mu Crystallin Antibody (NBP1-52867) (0)

There are no reviews for mu Crystallin Antibody (NBP1-52867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mu Crystallin Antibody (NBP1-52867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mu Crystallin Products

Bioinformatics Tool for mu Crystallin Antibody (NBP1-52867)

Discover related pathways, diseases and genes to mu Crystallin Antibody (NBP1-52867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mu Crystallin Antibody (NBP1-52867)

Discover more about diseases related to mu Crystallin Antibody (NBP1-52867).
 

Pathways for mu Crystallin Antibody (NBP1-52867)

View related products by pathway.

PTMs for mu Crystallin Antibody (NBP1-52867)

Learn more about PTMs related to mu Crystallin Antibody (NBP1-52867).
 

Research Areas for mu Crystallin Antibody (NBP1-52867)

Find related products by research area.

Blogs on mu Crystallin

There are no specific blogs for mu Crystallin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mu Crystallin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYM
Uniprot