MTH1 Antibody

Images

 
Western Blot: MTH1 Antibody [H00004521-D01P] - Analysis of NUDT1 expression in human kidney.
Western Blot: MTH1 Antibody [H00004521-D01P] - Analysis of NUDT1 expression in transfected 293T cell line by NUDT1 polyclonal antibody.Lane 1: NUDT1 transfected lysate(18.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTH1 Antibody Summary

Immunogen
NUDT1 (NP_002443.3, 1 a.a. - 156 a.a.) full-length human protein. MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Specificity
NUDT1 - nudix (nucleoside diphosphate linked moiety X)-type motif 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTH1 Antibody

  • 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase
  • EC 3.6.1.-
  • MTH1Nucleoside diphosphate-linked moiety X motif 1
  • mutT human homolog 1,8-oxo-dGTPase
  • nucleoside diphosphate-linked moiety X-type motif 17,8-dihydro-8-oxoguanine triphosphatase
  • nudix (nucleoside diphosphate linked moiety X)-type motif 1,8-oxo-7,8-dihydroguanosine triphosphatase
  • Nudix motif 1

Background

Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38436
Species: Hu
Applications: IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83131
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4885
Species: Mu
Applications: WB, IP
NBP2-35006
Species: Hu
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004521-D01P
Species: Hu
Applications: WB

Publications for MTH1 Antibody (H00004521-D01P) (0)

There are no publications for MTH1 Antibody (H00004521-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTH1 Antibody (H00004521-D01P) (0)

There are no reviews for MTH1 Antibody (H00004521-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTH1 Antibody (H00004521-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTH1 Products

Bioinformatics Tool for MTH1 Antibody (H00004521-D01P)

Discover related pathways, diseases and genes to MTH1 Antibody (H00004521-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTH1 Antibody (H00004521-D01P)

Discover more about diseases related to MTH1 Antibody (H00004521-D01P).
 

Pathways for MTH1 Antibody (H00004521-D01P)

View related products by pathway.

PTMs for MTH1 Antibody (H00004521-D01P)

Learn more about PTMs related to MTH1 Antibody (H00004521-D01P).
 

Research Areas for MTH1 Antibody (H00004521-D01P)

Find related products by research area.

Blogs on MTH1.

MTH1: Effects on DNA Damage Repair, Cancer and Neurodegeneration
MTH1 (human MutT Homolog 1) is a purine nucleoside triphosphatase enzyme and belongs to the Nudix hydrolase family. In mammalian systems, MTH is a major detoxifier of the oxidized DNA precursors, 8-oxo-dGTP, 8-oxo-dATP, and 2-OH-dATP and prevents the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT1
Entrez
Uniprot