MTAP Antibody (2G4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related MTAP Primary Antibodies

Order Details


    • Catalog Number
      H00004507-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MTAP Antibody (2G4) [PerCP] Summary

Immunogen
MTAP (AAH18625, 1 a.a. - 154 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Localization
Cytoplasmic
Specificity
MTAP - methylthioadenosine phosphorylase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTAP Antibody (2G4) [PerCP]

  • 5'-methylthioadenosine phosphorylase
  • c86fus
  • EC 2.4.2.28
  • methylthioadenosine phosphorylase
  • MSAPMeSAdo phosphorylase
  • MTA phosphorylase
  • MTAPase
  • S-methyl-5'-thioadenosine phosphorylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6486
Species: Hu
Applications: WB, Simple Western
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
H00004507-M01PCP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MTAP Antibody (H00004507-M01PCP) (0)

There are no publications for MTAP Antibody (H00004507-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTAP Antibody (H00004507-M01PCP) (0)

There are no reviews for MTAP Antibody (H00004507-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTAP Antibody (H00004507-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTAP Products

Bioinformatics Tool for MTAP Antibody (H00004507-M01PCP)

Discover related pathways, diseases and genes to MTAP Antibody (H00004507-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTAP Antibody (H00004507-M01PCP)

Discover more about diseases related to MTAP Antibody (H00004507-M01PCP).
 

Pathways for MTAP Antibody (H00004507-M01PCP)

View related products by pathway.

PTMs for MTAP Antibody (H00004507-M01PCP)

Learn more about PTMs related to MTAP Antibody (H00004507-M01PCP).

Blogs on MTAP

There are no specific blogs for MTAP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTAP Antibody (2G4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol MTAP