MTA2 Antibody

Images

 
There are currently no images for MTA2 Antibody (NBP2-87848).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTA2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MTA2. Peptide sequence: WKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MTA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTA2 Antibody

  • DKFZp686F2281
  • metastasis associated 1 family, member 2
  • metastasis -associated gene 1-like 1
  • metastasis associated gene family, member 2
  • Metastasis-associated 1-like 1
  • metastasis-associated protein 2
  • metastasis-associated protein MTA2
  • MTA1-L1 protein
  • MTA1L1MTA1-L1
  • p53 target protein in deacetylase complex
  • PID

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DCRP00
Species: Hu
Applications: ELISA
NB600-260
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB110-58360
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
6507-IL/CF
Species: Hu
Applications: BA

Publications for MTA2 Antibody (NBP2-87848) (0)

There are no publications for MTA2 Antibody (NBP2-87848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTA2 Antibody (NBP2-87848) (0)

There are no reviews for MTA2 Antibody (NBP2-87848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTA2 Antibody (NBP2-87848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTA2 Products

Array NBP2-87848

Bioinformatics Tool for MTA2 Antibody (NBP2-87848)

Discover related pathways, diseases and genes to MTA2 Antibody (NBP2-87848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTA2 Antibody (NBP2-87848)

Discover more about diseases related to MTA2 Antibody (NBP2-87848).
 

Pathways for MTA2 Antibody (NBP2-87848)

View related products by pathway.

PTMs for MTA2 Antibody (NBP2-87848)

Learn more about PTMs related to MTA2 Antibody (NBP2-87848).
 

Research Areas for MTA2 Antibody (NBP2-87848)

Find related products by research area.

Blogs on MTA2

There are no specific blogs for MTA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTA2