MSX2 Antibody (1F6) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related MSX2 Primary Antibodies

Order Details


    • Catalog Number
      H00004488-M04PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MSX2 Antibody (1F6) [PE] Summary

Immunogen
MSX2 (NP_002440, 101 a.a. - 201 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL*
Specificity
MSX2 (1F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MSX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MSX2 Antibody (1F6) [PE]

  • CRS2
  • CRS2parietal foramina 1
  • FPP
  • Homeobox protein Hox-8
  • homeobox protein MSX-2
  • Hox8
  • HOX8msh homeobox homolog 2 (Drosophila)
  • msh (Drosophila) homeo box homolog 2
  • msh homeo box 2
  • msh homeobox 2
  • msh homeobox homolog 2
  • MSH
  • MSX2
  • PFM
  • PFM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
H00004488-M04PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Msx2/Hox8 Antibody (H00004488-M04PE) (0)

There are no publications for Msx2/Hox8 Antibody (H00004488-M04PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Msx2/Hox8 Antibody (H00004488-M04PE) (0)

There are no reviews for Msx2/Hox8 Antibody (H00004488-M04PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Msx2/Hox8 Antibody (H00004488-M04PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSX2 Products

Bioinformatics Tool for Msx2/Hox8 Antibody (H00004488-M04PE)

Discover related pathways, diseases and genes to Msx2/Hox8 Antibody (H00004488-M04PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Msx2/Hox8 Antibody (H00004488-M04PE)

Discover more about diseases related to Msx2/Hox8 Antibody (H00004488-M04PE).
 

Pathways for Msx2/Hox8 Antibody (H00004488-M04PE)

View related products by pathway.

PTMs for Msx2/Hox8 Antibody (H00004488-M04PE)

Learn more about PTMs related to Msx2/Hox8 Antibody (H00004488-M04PE).
 

Research Areas for Msx2/Hox8 Antibody (H00004488-M04PE)

Find related products by research area.

Blogs on MSX2

There are no specific blogs for MSX2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSX2 Antibody (1F6) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol MSX2
Entrez